Recombinant Pichia pastoris Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
AIM36; FMP39; PAS_chr1-1_0384; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-268
Protein Length
Full Length of Mature Protein
Species
Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)
Target Names
AIM36
Target Protein Sequence
SNHPSSSFNNDGGPKVRHFLFVGLVGTMLFVLVVNKINEQDPKTSLAKKKNTYSEQEWES YVAGLKRKKQRFDSSSNKEFYAVPFANKNPKQIENLKRKVSKSSSQEDVGVVDINELIAK QMNNSESAYGLLLKTTLVENDPSSQSCTYSFNWNLAKGIFSKLVCDELTRMINESPQLDR FLLLNFPNNLPEAIKFEQDVANITELIVFNEEQKEDVVVKYFDTVDKVSISK
Uniprot No.

Target Background

Database Links
Protein Families
AIM36 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What distinguishes Pichia pastoris from Saccharomyces cerevisiae as an expression system for mitochondrial proteins?

P. pastoris exhibits distinct physiological adaptations compared to S. cerevisiae, particularly in response to environmental stresses like oxygen limitation. While adaptive responses to such stresses are extensively studied in S. cerevisiae, P. pastoris shows unique traits that can be advantageous for recombinant protein expression .

When expressing mitochondrial proteins like AIM36, these differences become particularly important. P. pastoris demonstrates strong transcriptional regulation of key metabolic pathways such as glycolysis, pentose phosphate pathway, and TCA cycle in response to hypoxia . This regulatory control allows for more precise manipulation of metabolic conditions during protein expression.

Additionally, P. pastoris exhibits important changes in lipid metabolism, stress responses, and protein folding/trafficking under hypoxic conditions, which can positively impact the production of functional mitochondrial proteins . These adaptations contribute to P. pastoris's superior capacity for high-density fermentation and enhanced protein secretion compared to S. cerevisiae when properly optimized.

How do oxygen conditions affect mitochondrial protein expression and function in P. pastoris?

Oxygen availability significantly impacts mitochondrial protein expression in P. pastoris through multiple mechanisms. Under hypoxic conditions, P. pastoris demonstrates a coordinated response across transcriptomic, proteomic and metabolic flux levels, indicating strong transcriptional regulation of core metabolism .

For mitochondrial proteins like AIM36, hypoxic conditions trigger several important adaptations:

  • Metabolic pathway shifts: Under low oxygen, P. pastoris adjusts its central carbon metabolism, affecting the energy available for protein synthesis and folding.

  • Stress response activation: Hypoxia induces stress responses that can impact protein folding and quality control mechanisms critical for proper mitochondrial protein assembly.

  • Altered lipid metabolism: Changes in lipid composition affect mitochondrial membrane integrity and function.

  • Protein trafficking modifications: Hypoxia alters protein trafficking pathways, potentially affecting the transport of mitochondrial proteins to their target locations .

Interestingly, studies have shown that controlled hypoxic conditions can actually enhance recombinant protein secretion in P. pastoris chemostat cultivations, suggesting that moderate oxygen limitation might optimize the production of proteins like AIM36 .

What systems biology approaches are most effective for studying AIM36 expression in P. pastoris?

A comprehensive systems biology approach integrating multiple data types provides the most effective strategy for studying AIM36 expression in P. pastoris. Based on successful approaches with other recombinant proteins, the following integrated methodology is recommended:

  • Gene expression profiling: Transcriptomic analysis to monitor changes in gene expression patterns related to AIM36 and interacting proteins under various conditions.

  • Proteomic analyses: Mass spectrometry-based proteomics to quantify AIM36 protein levels and post-translational modifications.

  • 13C isotope labeling: Experimental determination of metabolic fluxes in central carbon metabolism to understand how AIM36 expression affects cellular energetics .

  • Chemostat cultivations: Maintaining cells in steady-state conditions enables precise control of growth rate and environmental parameters, allowing for direct comparison between different oxygen conditions or genetic backgrounds .

This multi-level approach enables researchers to identify connections between transcriptional regulation, protein production, and metabolic adaptations related to AIM36 function. When these datasets are integrated, they reveal compensatory mechanisms and regulatory networks that might not be apparent from any single analysis method.

Data TypeTechniqueKey ParametersApplications for AIM36 Research
TranscriptomicsRNA-Seq or microarrayFold change, p-valueIdentify co-regulated genes, stress responses
ProteomicsLC-MS/MSProtein abundance, modificationsQuantify AIM36 expression, interaction partners
Metabolic flux13C labeling + GC-MSFlux ratios, pathway activityEnergy utilization, metabolic impact
PhysiologyChemostat cultivationGrowth rate, yield coefficientsPhenotypic effects of AIM36 expression

How should oxygen limitation be controlled in P. pastoris cultures to study its effects on AIM36 expression?

Precise control of oxygen availability is crucial when studying how hypoxia affects AIM36 expression in P. pastoris. Based on established protocols for recombinant protein studies, the following approach is recommended:

  • Chemostat cultivation system: Establish steady-state cultures under defined conditions where the dilution rate (D) equals the specific growth rate (μ). This provides stable and reproducible conditions essential for comparing different oxygen setpoints .

  • Dissolved oxygen (DO) monitoring: Use polarographic dissolved oxygen sensors to continuously monitor oxygen levels. For studying AIM36 expression, three key setpoints should be established:

    • Normoxic: DO > 30% air saturation

    • Oxygen-limited: DO around 5% air saturation

    • Hypoxic: DO < 1% air saturation

  • Gas mixture control: Use automated mass flow controllers to adjust the ratio of air/oxygen/nitrogen in the inlet gas to maintain desired DO setpoints.

  • Constant culture parameters: Maintain other parameters constant (pH, temperature, substrate feed rate) to isolate the effects of oxygen limitation on AIM36 expression.

  • Sampling considerations: Take samples for transcriptomic and proteomic analyses after at least 5 residence times at each steady state to ensure complete adaptation to the oxygen condition .

This approach allows researchers to distinguish between direct effects of oxygen limitation on AIM36 expression and secondary effects resulting from altered growth rate or metabolic state. The controlled environment of chemostat cultures provides the reproducibility needed for systems biology studies integrating multiple data types.

How does AIM36 influence the epigenetic inheritance of mitochondrial dysfunction in yeast models?

AIM36 may play a significant role in the epigenetic inheritance of mitochondrial function through several mechanisms that parallel those observed in other model systems. Based on comparative studies, the following pathways are likely involved:

While direct evidence for AIM36's role in epigenetic inheritance is still emerging, experimental approaches similar to those used in the International Mouse Phenotyping Consortium could be adapted to yeast models . These would involve creating heterozygous AIM36 mutants and assessing the phenotypes of wild-type progeny to detect non-genetic inheritance of mitochondrial traits.

The potential involvement of AIM36 in mitochondrial RNA processing makes it an intriguing target for understanding how mitochondrial status is communicated between generations independently of DNA sequence changes, representing an exciting frontier in yeast epigenetics research.

What methodologies are most effective for tracking the inheritance of mitochondrial proteins like AIM36 across generations in P. pastoris?

Tracking mitochondrial protein inheritance in P. pastoris requires sophisticated methodological approaches that combine genetic, microscopic, and biochemical techniques. For studying AIM36 inheritance specifically, the following integrated approach is recommended:

  • Fluorescent tagging strategies:

    • Create AIM36-GFP fusion proteins under native promoter control

    • Use photoactivatable fluorescent proteins (PA-GFP) to pulse-label specific mitochondrial populations

    • Implement dual-color labeling with distinct fluorophores for maternal and newly synthesized AIM36 pools

  • Time-lapse microscopy:

    • High-resolution confocal microscopy with environmental control chambers

    • Track labeled mitochondria through cell division events

    • Quantify redistribution patterns using automated image analysis

  • Genetic mtDNA tracking systems:

    • Leverage the genetic diversity of mtDNA to track parental origin of mitochondria

    • Similar to approaches in mouse models, use single-cell transcriptomics to monitor mt-tRNA transfer

    • Develop mtDNA barcoding systems to distinguish maternal from newly synthesized mitochondria

  • Biochemical fractionation and analysis:

    • Isolate pure mitochondrial fractions at different cell cycle stages

    • Quantify AIM36 levels and post-translational modifications using targeted proteomics

    • Analyze the association of AIM36 with mtDNA and other mitochondrial components

These approaches can be combined with genetic manipulations, such as creating conditional AIM36 mutants or varying expression levels, to determine how AIM36 impacts mitochondrial inheritance patterns. Particularly relevant is the potential role of AIM36 in the transmission of information about mitochondrial function status across generations, which could be elucidated by studying how stresses that induce mitochondrial dysfunction affect AIM36 dynamics and subsequent mitochondrial function in daughter cells.

How can researchers distinguish between direct effects of AIM36 manipulation and secondary metabolic adaptations in P. pastoris?

Distinguishing direct effects of AIM36 manipulation from secondary metabolic adaptations requires sophisticated experimental design and data analysis approaches. The following methodology is recommended:

  • Temporal resolution studies:

    • Implement time-course experiments after AIM36 induction or repression

    • Use statistical methods to identify early-responding vs. late-responding pathways

    • Early changes (minutes to hours) more likely represent direct effects, while later changes often reflect adaptive responses

  • Multi-level data integration:

    • Correlate transcriptomic, proteomic, and metabolic flux data to identify coherent patterns

    • As demonstrated in P. pastoris hypoxia studies, there is typically a positive correlation between these data types for direct regulatory relationships

    • Discrepancies between transcript and protein levels may indicate post-transcriptional regulation

  • Perturbation analysis:

    • Create a matrix of experimental conditions (oxygen levels, carbon sources, AIM36 expression levels)

    • Use multivariate statistical methods to decompose overlapping effects

    • Apply principal component analysis to identify major sources of variation in the dataset

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on AIM36

    • Use Graph theory metrics to identify direct interaction partners vs. downstream effectors

    • Calculate pathway enrichment scores to identify overrepresented functional categories

The following data analysis workflow provides a systematic approach to this problem:

Analysis StageMethodsOutcome
1. Initial screeningDifferential expression analysis with stringent FDR correctionIdentify significantly altered genes/proteins
2. Temporal clusteringSelf-organizing maps or k-means clusteringGroup genes by temporal response patterns
3. Network reconstructionBayesian network inference algorithmsInfer causal relationships between variables
4. ValidationTargeted experiments on key nodes in the networkConfirm direct vs. indirect relationships
5. Systems modelingFlux balance analysis with constraintsQuantify metabolic consequences of AIM36 perturbation

By systematically applying these approaches, researchers can develop a hierarchical model of AIM36 function that distinguishes between primary effects and secondary adaptations, similar to the multi-level analysis used in studying P. pastoris adaptation to hypoxia .

What statistical approaches are most appropriate for analyzing contradictory data in AIM36 research across different experimental conditions?

When confronted with contradictory data in AIM36 research, particularly across varying experimental conditions, researchers should employ robust statistical frameworks designed for heterogeneous data integration. The following approaches are recommended:

  • Meta-analysis techniques:

    • Apply random-effects models that account for between-study heterogeneity

    • Calculate effect sizes (Cohen's d or Hedges' g) rather than relying solely on p-values

    • Use forest plots to visualize the range of outcomes across different experimental conditions

  • Bayesian hierarchical modeling:

    • Develop models that explicitly incorporate experimental differences as random effects

    • Use Markov Chain Monte Carlo (MCMC) methods to estimate posterior probability distributions

    • Calculate Bayes factors to quantify evidence for competing hypotheses about AIM36 function

  • Multivariate analysis approaches:

    • Implement ANOVA designs with interaction terms to detect condition-dependent effects

    • Use partial least squares discriminant analysis (PLS-DA) to identify patterns in high-dimensional data

    • Apply canonical correlation analysis to relate different data types (e.g., transcriptomic and proteomic)

  • Robust regression techniques:

    • Employ methods resistant to outliers (M-estimators, MM-estimators)

    • Use bootstrapping to generate confidence intervals for parameter estimates

    • Implement cross-validation to assess model stability across different subsets of data

The contradictory results often observed in mitochondrial research can stem from subtle differences in experimental conditions. For example, the International Mouse Phenotyping Consortium demonstrated that mutations in different mitochondrial genes (Mrpl23, Ndufb8, and Tsfm) had dramatically different effects on offspring mitochondrial tRNA accumulation despite all being involved in mitochondrial function . This highlights the importance of gene-specific effects that might also apply to AIM36 research.

When analyzing such complex data, it's essential to:

  • Explicitly model the sources of experimental variation

  • Test for gene × environment interactions that might explain contradictory results

  • Consider non-linear relationships between AIM36 expression and phenotypic outcomes

  • Integrate qualitative research synthesis with quantitative meta-analysis

This combined approach will help researchers distinguish genuine biological complexity from experimental artifacts in the AIM36 literature.

What are the optimal protocols for isolating functional mitochondria from recombinant P. pastoris expressing AIM36?

Isolating functional mitochondria from recombinant P. pastoris expressing AIM36 requires specialized protocols that preserve both structural integrity and functional activity. Based on established methods for yeast mitochondrial isolation, the following optimized protocol is recommended:

  • Cell disruption optimization:

    • For P. pastoris cultures grown under different oxygen conditions, enzymatic digestion with zymolyase (2.5 mg/g wet weight) followed by gentle mechanical disruption using a Dounce homogenizer provides optimal results

    • Maintain temperature at 4°C throughout to prevent proteolytic degradation

    • Use sorbitol-based buffer (0.6M sorbitol, 10mM Tris-HCl pH 7.4, 1mM EDTA) supplemented with protease inhibitors

  • Differential centrifugation steps:

    • Initial centrifugation: 1,500 × g for 5 minutes to remove cell debris

    • Second centrifugation: 3,000 × g for 5 minutes to remove remaining cell fragments

    • Mitochondrial pellet: 12,000 × g for 15 minutes

    • Final purification: 12,000 × g for 15 minutes after resuspension

  • Density gradient purification:

    • Layer crude mitochondrial fraction on a 20-60% sucrose gradient

    • Centrifuge at 100,000 × g for 1 hour

    • Collect the mitochondrial band (typically at 40-45% sucrose interface)

    • Wash collected fraction in isolation buffer and pellet at 12,000 × g

  • Quality control assessments:

    • Respiratory control ratio (RCR) measurement using oxygen electrode

    • Membrane potential assessment using fluorescent dyes (JC-1 or TMRM)

    • Protein integrity verification by Western blotting for multiple mitochondrial markers

For researchers specifically interested in AIM36-expressing strains, several modifications to standard protocols are crucial:

  • Include pH stabilization during cell disruption (pH 7.2-7.4) to prevent artificial translocation of AIM36

  • Add phosphatase inhibitors to preservation buffers if studying AIM36 phosphorylation

  • Consider cross-linking prior to isolation if studying AIM36 interaction partners

Isolation StepStandard ProtocolOptimization for AIM36 Studies
Cell disruptionMechanical disruptionEnzymatic + gentle mechanical
Buffer compositionBasic isolation bufferAdd specific protease/phosphatase inhibitors
Gradient purificationOptionalMandatory for interaction studies
Functional assessmentBasic respirationMultiple parameters including membrane potential

These optimizations ensure that the isolated mitochondria maintain both structural integrity and functional activity, which is essential for studying the role of AIM36 in mitochondrial inheritance and function.

How can CRISPR-Cas9 gene editing be optimized for studying AIM36 function in P. pastoris?

CRISPR-Cas9 gene editing in P. pastoris requires specific optimizations when targeting mitochondrial proteins like AIM36. Based on recent advances in yeast genome editing, the following protocol has been optimized for studying AIM36 function:

  • Guide RNA design strategy:

    • Design multiple sgRNAs targeting the AIM36 coding sequence using P. pastoris-specific algorithms

    • Optimize GC content (40-60%) and avoid repetitive sequences

    • Screen for off-target effects using the P. pastoris genome database

    • For precise editing, design guides within 30bp of the desired modification site

  • Cas9 expression optimization:

    • Use codon-optimized Cas9 under the control of the AOX1 promoter for inducible expression

    • Alternative: constitutive expression using the GAP promoter for higher editing efficiency

    • Include a nuclear localization signal optimized for P. pastoris

    • Consider using Cas9 nickase (D10A) for reduced off-target effects when making subtle mutations

  • Delivery methods comparison:

    • Electroporation of ribonucleoprotein (RNP) complexes: highest efficiency for knockout studies

    • Plasmid-based delivery: better for complex edits requiring donor templates

    • Optimize electroporation parameters: 1.5 kV, 200 Ω, 25 μF for standard P. pastoris strains

  • Homology-directed repair templates:

    • For tagging AIM36: design 40-60bp homology arms flanking the insertion site

    • For point mutations: 80-100bp homology on each side of the target site

    • Include silent mutations in the PAM site to prevent re-cutting after repair

  • Selection and screening strategies:

    • Split-marker selection for integration events

    • Co-editing of ADE1 or ADE2 genes for visual screening (red/white colony selection)

    • High-throughput screening using quantitative PCR or digital droplet PCR

When specifically studying mitochondrial proteins like AIM36, additional considerations include:

  • Timing Cas9 expression to coincide with nuclear DNA replication

  • Creating conditional knockouts using inducible degradation domains if AIM36 is essential

  • Implementing multiplexed editing to simultaneously target AIM36 and interacting partners

Editing GoalOptimal StrategySuccess Verification
AIM36 knockoutRNP delivery with short homology armsWestern blot, phenotypic assays
Point mutationsPlasmid-based with long homology armsSequencing, functional assays
TaggingPlasmid with GFP/epitope tag and selection markerMicroscopy, immunoprecipitation
Conditional modificationsTwo-step process: tag integration then modificationRegulated expression validation

This optimized CRISPR-Cas9 system enables precise manipulation of AIM36 in P. pastoris, facilitating studies on its role in mitochondrial inheritance and function under various environmental conditions such as oxygen limitation .

How can researchers integrate transcriptomics, proteomics, and metabolomics data to understand AIM36 function in mitochondrial inheritance?

Integrating multi-omics data for understanding AIM36 function requires sophisticated computational approaches that capture relationships across biological organization levels. The following comprehensive strategy is recommended:

  • Data preparation and normalization:

    • Apply appropriate normalization methods for each data type (e.g., TPM for RNA-seq, intensity-based for proteomics)

    • Perform batch correction using ComBat or similar algorithms

    • Create unified gene/protein identifiers across platforms

    • Filter low-quality or low-confidence measurements

  • Multi-level correlation analysis:

    • Calculate pairwise correlations between transcripts, proteins, and metabolites

    • Identify concordant and discordant patterns across data types

    • Similar to P. pastoris hypoxia studies, examine correlations between transcript levels, protein abundance, and metabolic fluxes

    • Focus on relationships involving AIM36 and its known interaction partners

  • Network-based integration approaches:

    • Construct multilayer networks where nodes represent biomolecules and edges represent relationships

    • Apply algorithms like Similarity Network Fusion (SNF) to integrate multiple data types

    • Use random walk with restart (RWR) algorithms to prioritize genes/proteins connected to AIM36

    • Identify network modules enriched for mitochondrial inheritance processes

  • Causal modeling frameworks:

    • Implement Bayesian Networks to infer directional relationships

    • Use structural equation modeling to test specific hypotheses about AIM36 function

    • Apply Dynamic Bayesian Networks if time-course data is available

    • Validate key predictions with targeted experiments

The following integration workflow has proven effective for studying complex mitochondrial processes:

Integration StepTools/MethodsExpected Outcome
Initial data processingBioconductor packages, Perseus, MetaboAnalystClean, normalized datasets
Joint dimensionality reductionMulti-Omics Factor Analysis (MOFA), DIABLOMajor sources of variation across datasets
Network constructionWeighted Gene Correlation Network Analysis (WGCNA), keyPathwayMinerFunctional modules across data types
Pathway enrichmentConsensusPathDB, IMPaLABiological processes associated with AIM36
VisualizationOmicsIntegrator, mixOmicsIntegrated visual representations

This integration approach revealed important insights in studies of P. pastoris adaptation to hypoxia, showing strong transcriptional regulation of key metabolic pathways . Similar approaches would be valuable for understanding how AIM36 influences mitochondrial inheritance by identifying coordinated changes across organizational levels when AIM36 function is perturbed.

What computational tools are most effective for predicting the impact of AIM36 mutations on mitochondrial function in P. pastoris?

Predicting the functional impact of AIM36 mutations requires specialized computational tools that integrate structural biology, evolutionary conservation, and machine learning approaches. The following computational pipeline is recommended for comprehensive mutation effect prediction:

  • Structural prediction and analysis:

    • Generate AIM36 structural models using AlphaFold2 or RoseTTAFold

    • Refine models with molecular dynamics simulations (GROMACS, AMBER)

    • Calculate stability changes upon mutation (FoldX, DUET, mCSM)

    • Identify functional domains and binding interfaces using ConSurf and COACH-D

  • Evolutionary conservation approaches:

    • Generate multiple sequence alignments across fungal species

    • Calculate site-specific evolutionary rates using Rate4Site

    • Implement Evolutionary Action (EA) score to quantify mutation impact

    • Use SCSMut to identify structurally conserved surface mutations

  • Machine learning predictors:

    • Ensemble approach combining multiple predictors:

      • PROVEAN for sequence-based prediction

      • PolyPhen-2 for structure-function relationships

      • SNAP2 for functional effects

      • MutPred2 for molecular mechanisms

    • Train custom predictors using yeast-specific datasets if available

  • Systems-level impact prediction:

    • Use genome-scale metabolic models to predict metabolic consequences

    • Implement protein-protein interaction network perturbation analysis

    • Apply flux balance analysis to predict growth phenotypes

    • Simulate mitochondrial energetics using kinetic models

When specifically studying AIM36 mutations affecting mitochondrial inheritance, certain computational approaches have proven particularly valuable:

Mutation TypeRecommended ToolsKey Parameters
Catalytic site mutationsSAAFEC, Minimotif MinerConservation score, binding energy change
Interface mutationsmCSM-PPI2, MutaBind2ΔΔG of interaction, interface disruption score
Stability mutationsINPS-MD, DynaMutFree energy change, flexibility alteration
Regulatory site mutationsGPS, NetPhosPost-translational modification potential

These computational predictions should be integrated with experimental validation approaches. For example, mutations predicted to significantly impact AIM36 function could be introduced using the CRISPR-Cas9 system described earlier, and their effects on mitochondrial inheritance could be assessed using microscopy and functional assays.

The computational pipeline can also prioritize mutations for experimental testing based on their predicted impact severity, helping researchers focus on the most promising candidates for understanding AIM36's role in mitochondrial inheritance in P. pastoris.

What are the most promising future research directions for understanding AIM36 function in P. pastoris?

Based on current knowledge gaps and emerging technologies, several high-priority research directions hold particular promise for advancing our understanding of AIM36 function in P. pastoris:

  • Single-cell multi-omics approaches: Implementing single-cell transcriptomics and proteomics to understand cell-to-cell variability in AIM36 expression and function. This approach could reveal whether heterogeneity in mitochondrial inheritance patterns correlates with AIM36 levels in individual cells.

  • Cryo-electron tomography studies: Using advanced structural biology techniques to visualize AIM36 in its native mitochondrial context, potentially revealing its spatial organization and interactions with other mitochondrial components at near-atomic resolution.

  • In vivo dynamics using advanced microscopy: Implementing techniques like lattice light-sheet microscopy combined with optogenetic tools to visualize and manipulate AIM36 function in living cells with minimal phototoxicity over extended time periods.

  • Synthetic biology approaches: Creating minimal mitochondrial systems with defined components to determine the sufficient and necessary factors for AIM36-mediated inheritance. This could involve reconstitution experiments in liposomes or minimal cell systems.

  • Comparative studies across yeast species: Expanding research beyond P. pastoris to include comparative studies with S. cerevisiae and other yeast species, leveraging the differences in mitochondrial biology to gain insights into conserved and divergent functions of AIM36 .

  • Integration with epigenetic inheritance mechanisms: Exploring potential parallels between mitochondrial inheritance mechanisms in yeast and the epigenetic inheritance of mitochondrial dysfunction observed in mammals, focusing on whether small RNAs play similar roles across species .

These research directions would benefit from integrating the systems biology approaches that have proven successful in studying P. pastoris adaptation to hypoxia with the genetic approaches used to study epigenetic inheritance of mitochondrial function in mice . This integration would provide a comprehensive understanding of how AIM36 contributes to mitochondrial inheritance in the context of changing environmental conditions, potentially revealing new principles of non-genetic inheritance that could be relevant across eukaryotic species.

How might findings from AIM36 research in P. pastoris translate to understanding mitochondrial inheritance in higher eukaryotes?

Findings from AIM36 research in P. pastoris have significant potential to enhance our understanding of mitochondrial inheritance mechanisms in higher eukaryotes through several translational pathways:

  • Conserved molecular mechanisms: While specific proteins may differ, core mechanisms of mitochondrial quality control, division, and inheritance are often conserved from yeast to humans. Discoveries about how AIM36 regulates these processes in P. pastoris could reveal fundamental principles applicable across species.

  • Small RNA transmission pathways: Recent research in mammals has revealed that mitochondrial-encoded tRNAs (mt-tRNAs) and their fragments play important roles in epigenetic inheritance . If AIM36 is found to influence similar small RNA dynamics in yeast, this could represent a conserved mechanism for transmitting information about mitochondrial status across generations.

  • Stress response integration: The adaptation of P. pastoris to hypoxia involves coordinated changes in transcription, protein expression, and metabolic flux . Understanding how AIM36 participates in this response could illuminate how mitochondrial proteins in higher eukaryotes coordinate cellular adaptations to environmental challenges.

  • Protein quality control mechanisms: If AIM36 participates in mitochondrial protein quality control in P. pastoris, these findings could inform research on mitochondrial dysfunction in human diseases, particularly neurodegenerative disorders where mitochondrial proteostasis is compromised.

  • Metabolic reprogramming insights: Studies in mice have shown that paternal mitochondrial dysfunction can reprogram offspring metabolism . If AIM36 research in P. pastoris reveals mechanisms for transmitting information about mitochondrial metabolic state, these could be relevant to understanding metabolic programming in mammals.

The translational value of this research is highlighted by parallels between yeast and mammalian systems. For example, the International Mouse Phenotyping Consortium found that mutations in mitochondrial genes led to accumulation of 5′ mt-tsRNAs and alterations in offspring glucose metabolism , suggesting mechanisms that might be conserved from yeast to mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.