Recombinant Pichia pastoris Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Discovery and Localization of FCJ1

FCJ1 was first identified and characterized in yeast, where it was found to be specifically enriched in CJs . The absence of FCJ1 results in the loss of CJs, leading to concentric stacks of inner membrane within the mitochondrial matrix and increased levels of F1F0-ATP synthase supercomplexes . Overexpression of FCJ1 leads to an increase in CJ formation, branching of cristae, enlargement of CJ diameter, and reduced levels of F1F0 supercomplexes .

Structure and Function

FCJ1 is part of a large multisubunit complex known as MICOS/MINOS/MitOS, which plays a central role in the formation of CJs and in determining cristae morphology . The C-terminal domain of Fcj1 is crucial for the formation of stable CJs and is required for the genetic interaction of Fcj1 with the F1F0 ATP synthase .

FCJ1 modulates CJ formation in an antagonistic manner to the subunits e and g of the F1F0 ATP synthase, influencing the oligomerization state of the F1F0 ATP synthase, which is essential for cristae structure .

Role in Mitochondrial Morphology and Function

FCJ1 plays a direct role in determining the number and architecture of CJs . Overexpression of FCJ1 increases the number of CJs per cell and leads to increased branching of cristae . Down-regulation of FCJ1 leads to a progressive decrease in the number of CJs and cristae branches .

Interaction with mtDNA

FCJ1 interacts with the nucleoid protein Abf2, suggesting a role in maintaining the distribution and size of mtDNA nucleoids .

FCJ1 and F1F0-ATP Synthase

FCJ1 has a regulatory influence on the oligomeric state of F1F0 . Deletion of FCJ1 leads to an increase in the level of F1F0 supercomplexes, while overexpression of FCJ1 leads to a reduction in the level of F1F0 supercomplexes .

Genetic Interactions

A genetic interaction exists between FCJ1 and Su e/Su g of F1F0, placing all proteins in the same pathway . The latter subunits promote the assembly of F1F0-ATP synthase oligomers, whereas FCJ1 has the opposite effect .

FCJ1 Orthologues

The mammalian protein mitofilin/IMMT is likely an orthologue of FCJ1, based on its depletion phenotype .

Recombinant FCJ1

Recombinant FCJ1 can be produced in vitro using an E. coli expression system .

Data Table

FeatureDescription
Protein NameFormation of crista junctions protein 1 (FCJ1)
OrganismPichia pastoris
FunctionEssential for the formation of crista junctions (CJs) and the maintenance of mitochondrial structure and function
LocalizationMitochondrial inner membrane, specifically enriched in CJs
InteractionInteracts with subunits e and g of the F1F0 ATP synthase, and the nucleoid protein Abf2
Effect of DeletionLoss of CJs, concentric stacks of inner membrane, increased levels of F1F0-ATP synthase supercomplexes
Effect of OverexpressionIncreased CJ formation, branching of cristae, enlargement of CJ diameter, reduced levels of F1F0 supercomplexes
Multisubunit ComplexPart of the MICOS/MINOS/MitOS complex, which plays a central role in the formation of CJs and in determining cristae morphology
C-terminal DomainCrucial for the formation of stable CJs and required for the genetic interaction of Fcj1 with the F1F0 ATP synthase
OrthologueMitofilin/IMMT in mammals

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIC60; PAS_chr1-4_0172; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-509
Protein Length
Full Length of Mature Protein
Species
Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)
Target Names
MIC60
Target Protein Sequence
QSTNPTVKKSKPLRKFLFRLGLLTGVFYAGGVAVSLKNDIVQDAFIEHVPLGEALLDFTE YYVNHPEELSFSSTKQKLQNFDKTVLIPKRGVQSAKVEDVEHIKNVTRGSADESVSLSKT IYSNLNLPSIDLEFKDEVLQSSVEHLNHLIDTIRTQVNTVDLLPQVEQLKSSIKELGSKY NSFVTDRNTAVEEALAKLDDELKTKYQNKELALTDKYISDLQETKRQIELKHDQILAKEL DTAQRRILLEAENIIVQARINTLSEFESIISDKIDNERNGKLKNLDALAKRVEELENVQI KLFDNISNAEKLTNLKKTVSKINRLLISSNDGVDAKTLINEVNKFKTYSKDLNNELISSV LLNLPNDKALSNGVLSQAQLLARWDLLTPELRSASLLPPNAGILGHLSSKLFSFFLLGKS GTPTSGNDIESVISRVHDNLLKNRLDDALEEVSSLKGWSRKLSEDWIVEARKKLELQVLV GVLENEVSLL
Uniprot No.

Target Background

Function

Recombinant Pichia pastoris Formation of crista junctions protein 1 (FCJ1) is a component of the MICOS complex, a large protein complex within the mitochondrial inner membrane. This complex plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and establishing contact sites with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane. Furthermore, it facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.