Recombinant Pichia pastoris Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Description

GET Pathway Overview

The GET pathway is crucial for maintaining cellular function by ensuring proper localization of TA proteins . This pathway involves several proteins that work together to recognize, target, and insert TA proteins into the ER membrane .

Key components of the GET pathway:

  • Get3: A cytosolic chaperone that binds to the TA substrate .

  • Get4/Get5: A complex that recruits Get3 to the ER membrane .

  • Get1/Get2: Membrane proteins that form the insertase complex, facilitating the insertion of the TA protein into the ER membrane .

In Pichia pastoris, the GET pathway functions similarly to that in other eukaryotes . Disruptions in the GET pathway can lead to mislocalization of TA proteins, causing cellular dysfunction and disease .

Pichia pastoris as an Expression System

Pichia pastoris is a methylotrophic yeast widely used for recombinant protein production due to its ability to grow to high cell densities and its strong, inducible promoters such as the alcohol oxidase 1 (AOX1) promoter . This makes it an ideal host for expressing proteins like GET1 .

Advantages of using Pichia pastoris:

  • High cell density: P. pastoris can be cultured to high densities, resulting in high protein yields .

  • Strong promoters: The AOX1 promoter is tightly regulated and can be induced by methanol, allowing for controlled protein expression .

  • Secretion capability: P. pastoris can secrete recombinant proteins into the culture medium, simplifying purification .

  • Post-translational modifications: P. pastoris can perform eukaryotic post-translational modifications, which are important for the function of many proteins .

GT1 in Pichia pastoris

GT1, a glycerol transporter in Pichia pastoris, plays a role in the regulation of recombinant protein expression. Studies have shown that deleting GT1 can eliminate glycerol repression of the AOX1 promoter, leading to constitutive expression of recombinant proteins .

Role of GT1:

  • Glycerol transport: GT1 transports glycerol into the cell .

  • Regulation of AOX1: GT1 is involved in the glycerol-mediated repression of the AOX1 promoter .

  • Constitutive expression: Knocking out GT1 results in constitutive expression of AOX1, which can be useful for certain applications .

Structure and Function of GET1

GET1 is a subunit of the membrane insertase complex, which also includes GET2 . The GET1/GET2 complex facilitates the insertion of TA proteins into the ER membrane. Structural studies have revealed that the GET1/GET2 heterodimer is conserved across eukaryotes and maintains key structural features important for its function .

Key structural and functional aspects of GET1/GET2:

  • Heterodimer formation: GET1 and GET2 form a stable heterodimer .

  • Membrane insertion: The complex facilitates the insertion of TA proteins into the ER membrane .

  • Conserved structure: The structure of the GET1/GET2 complex is conserved from yeast to humans .

  • Conformational changes: The GET1/GET2 heterotetramer undergoes conformational changes that are important for its function .

Research Findings and Significance

Recent research has focused on understanding the structure and function of the GET insertase complex. Cryo-EM studies have provided insights into the conformational changes and interactions of GET1/GET2 with other components of the GET pathway .

Notable research findings:

  • The GET1/GET2 heterotetramer undergoes conformational changes in response to interactions with Get3 .

  • The structure of the GET1/GET2 complex is conserved across different species .

  • The transmembrane domains (TMDs) of GET1 and GET2 are crucial for the stability and function of the complex .

  • Mutations in GET1/GET2 can disrupt the GET pathway, leading to mislocalization of TA proteins .

Applications and Future Directions

Understanding the GET pathway and the role of GET1 has several potential applications:

  • Biotechnology: Optimizing protein production in Pichia pastoris by manipulating the GET pathway .

  • Drug discovery: Targeting the GET pathway for therapeutic interventions in diseases related to TA protein mislocalization .

  • Basic research: Further elucidating the mechanisms of protein targeting and insertion into the ER membrane .

Further research is needed to fully understand the intricacies of the GET pathway and its regulation. This includes:

  • Investigating the role of lipids in the GET pathway .

  • Identifying novel regulators of GET1 expression and function .

  • Developing high-throughput screens to identify compounds that modulate the GET pathway .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET1; PAS_chr4_0403; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)
Target Names
GET1
Target Protein Sequence
MDPFSILLTLTLIILAQNAVRIVGKSQIHQSIWNLYLRYSNDQQILKLRNLKAESYDVYK QRSNTSAQDEYAKWTKLNRKYDQLQTEIKAVSDQVSQQQQAIEKYLGLAISVTTTLPLWL FRFKYRKQPLFYFPKDTFPSYLEWILSFPSVPQGSIGIMFWILLLNKFVSNLEFIVKTFS TKVEKPVPIVKVEDLSPK
Uniprot No.

Target Background

Function

Recombinant Pichia pastoris Golgi to ER traffic protein 1 (GET1) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3. GET3 specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the role of GET1 in Pichia pastoris and why is it important for recombinant protein production?

GET1 (Golgi to ER Traffic protein 1) plays a critical role in retrograde protein transport from the Golgi apparatus to the endoplasmic reticulum (ER) in Pichia pastoris. This protein is part of the cellular machinery that maintains proper protein folding and quality control. In recombinant protein production, GET1 affects secretory capacity by regulating protein trafficking between cellular compartments.

The efficient functionality of GET1 is particularly important in P. pastoris expression systems because this yeast has been established as an efficient platform for recombinant protein production due to its higher folding efficiency, high cell density fermentation capabilities, strong expression systems, genetic stability, and mature secretion system . When producing heterologous proteins, limitations in folding and secretion often become apparent, and proper trafficking mediated by proteins like GET1 can be critical bottlenecks in the production process .

How does GET1 influence the unfolded protein response (UPR) in Pichia pastoris?

GET1 is involved in maintaining ER homeostasis, which is directly linked to the unfolded protein response (UPR). When recombinant proteins are overexpressed in P. pastoris, misfolded proteins can accumulate in the ER, triggering the UPR pathway. GET1, by facilitating retrograde transport, helps to alleviate ER stress by ensuring proper protein trafficking.

Evidence from transcriptional analysis shows that UPR activation in P. pastoris results in upregulation of several ER-resident chaperones and folding assistants, including BiP (5-fold increase), PDI1 (3-fold increase), ERO1 (2-fold increase), and SEC61 (2-fold increase) . The interplay between these UPR components and trafficking proteins like GET1 is crucial for maintaining cellular health during recombinant protein production. Strains with optimized GET1 expression may exhibit altered UPR responses, potentially affecting these marker genes differently.

What expression systems and promoters are most suitable for GET1 overexpression in Pichia pastoris?

For GET1 overexpression in P. pastoris, selection of an appropriate promoter depends on your experimental goals. The two most commonly used promoters are:

  • AOX1 promoter (P AOX1): This methanol-inducible promoter is the most widely used for controlled expression. It enables the decoupling of cell growth and protein production phases, which is beneficial when GET1 overexpression might affect cell viability. The P AOX1 can be strictly inhibited by glucose or glycerol and triggered by methanol .

  • GAP promoter (P GAP): This constitutive promoter is suitable when continuous GET1 expression is desired. It doesn't require the toxic and flammable methanol for induction, simplifying the cultivation process .

Recent advances have also introduced engineered promoter variants (EPVs) that show stronger performance than natural promoters. For instance, hybrid-promoter architectures using de novo synthetic sequences to replace native cis-acting DNA elements offer enhanced expression capabilities . For GET1 studies, these advanced promoters could provide more precise control over expression levels.

What are the common challenges in detecting and quantifying GET1 in Pichia pastoris?

Detection and quantification of GET1 in P. pastoris present several challenges:

  • Low natural expression levels: As a trafficking protein, GET1 is typically expressed at low levels, making detection challenging using standard methods.

  • Membrane protein isolation: GET1 is a membrane-associated protein, requiring specialized extraction protocols using appropriate detergents.

  • Antibody availability: Specific antibodies against P. pastoris GET1 may not be commercially available, necessitating the use of epitope tags.

  • Quantification methods: For precise quantification, techniques such as:

    • Western blotting with appropriate controls

    • Mass spectrometry-based approaches

    • Quantitative real-time PCR for transcript levels

When working with recombinant GET1, immunofluorescent staining and flow cytometry can be effective for detecting intracellularly retained protein, which is typically located within the membrane fraction of cell lysates containing compartments of the secretory pathway like the ER and Golgi .

How can CRISPR/Cas9 gene editing be optimized for GET1 modification in Pichia pastoris strains?

Optimizing CRISPR/Cas9 for GET1 modification in P. pastoris requires careful consideration of several factors:

Guide RNA Design:

  • Select guide RNAs with minimal off-target effects using P. pastoris-specific prediction tools

  • Aim for target sites near the 5' end of the GET1 coding sequence when creating knockouts

  • For precise editing, design homology-directed repair (HDR) templates with at least 500 bp homology arms

Delivery Methods:

  • Transformation efficiency can be improved using electroporation with linearized plasmids

  • Consider ribonucleoprotein (RNP) complex delivery to reduce off-target effects and avoid genomic integration of Cas9

Screening and Validation:

  • Implement a two-step screening approach: first PCR-based genotyping, then confirmation by Sanger sequencing

  • For subtle modifications, restriction fragment length polymorphism (RFLP) analysis can be useful

  • Validate edited strains by RNA-seq or RT-qPCR to assess GET1 expression levels

Recent advances in CRISPR/Cas9 systems have greatly improved the efficiency of gene editing in P. pastoris . When applied to GET1 modification, researchers should consider using P. pastoris-optimized Cas9 variants and promoters to enhance editing efficiency while minimizing cellular stress.

What experimental design approaches are most effective for studying GET1's impact on recombinant protein secretion in Pichia pastoris?

To effectively study GET1's impact on recombinant protein secretion, a systematic experimental design approach is essential:

True Experimental Design with Control vs. Experimental Groups:

  • Generate isogenic strains differing only in GET1 expression (wild-type, knockout, overexpression)

  • Randomly assign replicates to different treatment conditions to control for extraneous variables

  • Ensure sufficient biological replicates (minimum n=3) for statistical validity

Variable Manipulation Strategy:

  • Independent Variables:

    • GET1 expression levels (native, overexpression, knockout)

    • Cultivation conditions (temperature, pH, media composition)

    • Model recombinant protein types (simple proteins, complex multi-domain proteins)

  • Dependent Variables:

    • Secretion efficiency (% secreted vs. intracellular)

    • Product quality (glycosylation patterns, activity)

    • Growth parameters (biomass yield, specific growth rate)

    • UPR marker gene expression

Recommended Experimental Layout:

GET1 StatusModel ProteinCultivation ConditionMeasurements
Wild-typeProtein AStandard (30°C, pH 6.0)Secretion, UPR markers, Growth
Wild-typeProtein AStress (34°C, pH 5.0)Secretion, UPR markers, Growth
GET1 OverexpressionProtein AStandard (30°C, pH 6.0)Secretion, UPR markers, Growth
GET1 OverexpressionProtein AStress (34°C, pH 6.0)Secretion, UPR markers, Growth
GET1 KnockoutProtein AStandard (30°C, pH 6.0)Secretion, UPR markers, Growth
GET1 KnockoutProtein AStress (34°C, pH 5.0)Secretion, UPR markers, Growth

This factorial design allows for rigorous statistical analysis of GET1's effects under various conditions, helping to isolate its specific contribution to the secretory pathway .

How does GET1 interact with the unfolded protein response machinery during heterologous protein expression in Pichia pastoris?

The interaction between GET1 and UPR machinery during heterologous protein expression involves complex regulatory networks:

Transcriptional Coordination:
GET1 function is intricately linked with UPR components. When heterologous proteins are expressed, transcriptional analysis reveals upregulation of key UPR genes. Experiments with Hac1p overexpression (a UPR transcription factor) in P. pastoris have shown significant upregulation of:

  • KAR2 (BiP, 5-fold increase)

  • PDI1 (protein disulfide isomerase, 3-fold increase)

  • ERO1 (Pdi oxidase, 2-fold increase)

  • SEC61 (translocon complex component, 2-fold increase)

GET1 likely interacts with these pathways, as proper trafficking between ER and Golgi is essential when UPR is activated.

Experimental Approach to Study Interactions:

  • Perform co-immunoprecipitation studies with tagged GET1 to identify binding partners

  • Use fluorescence resonance energy transfer (FRET) to visualize real-time interactions between GET1 and UPR components

  • Conduct genetic epistasis experiments by creating double mutants of GET1 and UPR components

  • Implement proteomics analyses to track changes in the GET1 interactome under UPR-inducing conditions

Regulatory Network:
GET1 may be part of a feedback loop wherein UPR activation alters GET1 function or expression, which then modulates ER stress levels. This hypothesis can be tested by monitoring GET1 expression and localization during various stages of UPR activation using time-course experiments and subcellular fractionation techniques.

What are the latest methodologies for analyzing GET1 trafficking dynamics in real-time during recombinant protein production?

Recent advances in imaging and biosensor technologies have opened new possibilities for analyzing GET1 trafficking dynamics:

Advanced Fluorescence Microscopy Approaches:

  • Fluorescence Recovery After Photobleaching (FRAP): By tagging GET1 with fluorescent proteins and selectively photobleaching regions of interest, researchers can measure the mobility and trafficking rates of GET1 between cellular compartments.

  • Super-Resolution Microscopy: Techniques such as Stimulated Emission Depletion (STED) or Photoactivated Localization Microscopy (PALM) allow visualization of GET1 localization at nanometer resolution, revealing detailed trafficking patterns not visible with conventional microscopy.

  • Lattice Light-Sheet Microscopy: Enables long-term 3D imaging with minimal phototoxicity, ideal for tracking GET1 movement during extended protein production periods.

Biosensor Development for Real-time Monitoring:

  • FRET-based biosensors can be designed to detect GET1 conformational changes during cargo binding

  • pH-sensitive GET1 tags to distinguish between Golgi (pH ~6.5) and ER (pH ~7.2) localization

  • Split-fluorescent protein approaches to visualize GET1 interactions with specific cargo proteins

Quantitative Analysis Workflows:

  • Implement machine learning algorithms for automated tracking of GET1-positive vesicles

  • Develop mathematical models of GET1 trafficking kinetics under various expression conditions

  • Correlate trafficking dynamics with UPR marker expression and secretion efficiency using multivariate statistical approaches

These methodologies should be implemented with appropriate controls and validated using complementary biochemical approaches to ensure robust interpretation of GET1 dynamics.

How can mathematical modeling be applied to predict the effect of GET1 manipulation on recombinant protein yields in Pichia pastoris?

Mathematical modeling provides powerful tools for predicting how GET1 manipulation might affect recombinant protein production:

Systems Biology Modeling Approaches:

Model Calibration and Validation:

  • Use experimental data from controlled GET1 expression studies to calibrate model parameters

  • Implement sensitivity analysis to identify which parameters most strongly influence model predictions

  • Validate models with independent experiments not used in the calibration step

Practical Application Example:

ParameterWild-type GET1GET1 OverexpressionGET1 Knockout
ER-to-Golgi transport rate (min⁻¹)0.420.670.18
Golgi-to-ER retrieval rate (min⁻¹)0.350.530.09
UPR activation threshold (AU)10014562
Predicted max protein yield (g/L)8.312.73.5
Predicted cultivation time (h)726896

These model predictions can guide experimental design by identifying optimal GET1 expression levels for specific recombinant proteins and cultivation conditions .

What are the methodological considerations for resolving contradictory data when studying GET1 function in different Pichia pastoris strains?

When faced with contradictory data regarding GET1 function across different P. pastoris strains, researchers should implement a systematic approach to resolve discrepancies:

Source Identification for Contradictions:

  • Strain-specific differences: Different P. pastoris strains (e.g., GS115, KM71, X-33) may have natural variations in secretory pathway regulation

  • Experimental conditions: Subtle differences in media composition, pH, temperature, or oxygen transfer can significantly affect protein trafficking

  • Measurement methodologies: Various techniques for assessing GET1 function may have different sensitivities and biases

  • Expression construct design: Variations in promoters, terminators, or codon optimization can alter GET1 expression patterns

Resolution Strategy:

Standardization Protocol:

  • Establish consistent cultivation conditions across experiments

  • Implement standardized analytical procedures with appropriate internal standards

  • Use isogenic strains that differ only in the specific genetic modification being studied

Cross-validation Approach:

  • Apply multiple independent methods to measure the same parameter

  • Perform inter-laboratory validation if possible

  • Test hypotheses under varying conditions to determine the boundaries of observed effects

Meta-analysis Framework:

  • Systematically document all experimental variables that might affect outcomes

  • Use statistical methods designed for heterogeneous data sets

  • Implement Bayesian approaches to incorporate prior knowledge when interpreting new results

Decision Tree for Resolving Contradictions:

  • Replicate original experiments with detailed documentation

  • Identify all variables that differ between contradictory studies

  • Systematically test each variable's contribution to the observed differences

  • Develop a unified model that explains the apparently contradictory results

  • Validate the model with new, targeted experiments

What protocols yield the highest quality GET1 protein when expressing it recombinantly in Pichia pastoris?

Optimizing GET1 expression in P. pastoris requires attention to several critical factors:

Expression Vector Design:

  • Include a purification tag (such as 6xHis or FLAG) at the C-terminus to minimize interference with N-terminal signal sequences

  • Optimize codon usage specifically for P. pastoris high-expression genes

  • Consider including a TEV protease cleavage site for tag removal

  • Use AOX1 promoter for tight control of expression timing, particularly important for membrane proteins like GET1

Cultivation Strategy:

  • Two-Phase Protocol:

    • Initial biomass generation phase using glycerol as carbon source

    • Induction phase using methanol feeding at 0.5-1.0% (v/v) for AOX1-driven expression

  • Temperature Optimization:

    • Lower cultivation temperature to 20-25°C during induction phase

    • This reduction helps prevent protein aggregation and improves folding of membrane proteins

  • Supplementation Strategy:

    • Add 0.1-0.5% casamino acids to reduce proteolytic degradation

    • Include 5-10% sorbitol as co-substrate during methanol induction to balance growth and expression

Extraction and Purification Protocol:

  • Cell disruption using glass beads in buffer containing 1% DDM (n-dodecyl β-D-maltoside)

  • Solubilization of membrane fraction using 2% LMNG (lauryl maltose neopentyl glycol)

  • Purification using IMAC followed by size exclusion chromatography

  • Quality assessment using SDS-PAGE, western blotting, and functional assays

This approach has been shown to yield functionally active membrane proteins while maintaining their native conformation and trafficking capabilities.

How can researchers troubleshoot GET1 expression issues in Pichia pastoris heterologous expression systems?

When troubleshooting GET1 expression issues, a systematic approach is essential:

Diagnostic Framework for GET1 Expression Problems:

  • No detectable GET1 expression:

    • Verify vector sequence and integration using PCR and sequencing

    • Check methanol utilization phenotype (Mut+ or MutS)

    • Confirm promoter functionality using a reporter gene

    • Evaluate mRNA levels using RT-qPCR to determine if the issue is transcriptional

    • Solution: Redesign construct with different promoter or optimize induction conditions

  • Low GET1 expression levels:

    • Optimize codon usage for P. pastoris

    • Adjust induction parameters (methanol concentration, temperature, duration)

    • Try different signal sequences or fusion partners

    • Solution: Implement fed-batch strategy with controlled methanol feeding

  • GET1 protein degradation:

    • Add protease inhibitors during extraction

    • Use protease-deficient strains (SMD1168)

    • Optimize pH and temperature during cultivation

    • Solution: Reduce cultivation temperature to 20°C during induction phase

  • Mislocalized or aggregated GET1:

    • Verify subcellular localization using fractionation and immunoblotting

    • Analyze protein solubility in different detergents

    • Check UPR activation markers (BiP, PDI1)

    • Solution: Co-express chaperones or foldases to improve folding

Experimental Verification Steps:

When implementing solutions, follow this verification workflow:

  • Make one change at a time and document results

  • Use positive controls (well-expressed proteins) in parallel

  • Implement analytical methods that can detect even low levels of expression

  • Validate functional activity of the expressed GET1 protein

This troubleshooting approach combines insights from both membrane protein expression strategies and the specific biology of the P. pastoris expression system .

What are the most effective strategies for analyzing GET1 interactions with other components of the secretory pathway in Pichia pastoris?

Several complementary strategies can be employed to comprehensively analyze GET1 interactions within the secretory pathway:

Molecular Interaction Analysis Techniques:

  • Proximity-based Approaches:

    • BioID: Fusion of GET1 with a promiscuous biotin ligase to biotinylate proteins in close proximity

    • APEX2 labeling: GET1-APEX2 fusion for electron microscopy visualization and proteomic identification of neighbors

    • Split-BioID: For detecting specific interaction partners with reduced background

  • Protein-Protein Interaction Methods:

    • Co-immunoprecipitation: Using epitope-tagged GET1 followed by mass spectrometry

    • Yeast two-hybrid: Modified for membrane proteins using split-ubiquitin systems

    • FRET/BRET: For real-time interaction monitoring in living cells

  • Genetic Interaction Mapping:

    • Synthetic genetic arrays: Systematic analysis of genetic interactions between GET1 and other secretory pathway genes

    • CRISPR interference screens: Identifying genes that modulate GET1 function

    • Multicopy suppressor screens: Identifying genes that can compensate for GET1 deficiency

Data Integration and Visualization:

To make sense of complex interaction data, implement:

  • Network analysis tools to visualize interaction patterns

  • GO term enrichment analysis to identify functional clusters

  • Comparative analysis with known secretory pathway maps from model organisms

  • Correlation with UPR activation data to identify stress-responsive interactions

Validation Strategy:

For each identified interaction:

  • Confirm using at least two independent methods

  • Test the functional significance by disrupting the interaction

  • Assess conservation across different yeast species

  • Map the interaction domains using truncation or point mutations

This multi-faceted approach leverages the strengths of various techniques to build a comprehensive understanding of GET1's role in the secretory network .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.