Recombinant Pichia pastoris Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET2; PAS_chr3_0197; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)
Target Names
GET2
Target Protein Sequence
MSELTEAEKRQLLREKRKAKLSQGGGLDRLKKITGENNSKLSTDVPTKEPTADATTTATE LPTQGLETRINAHDDPVSEIPDPLNEGFDGKEPDLDQLIASMFNKSAGHENPNSEEQGVP ELMRRFSSILQGGDSGAAGLGAEAGGINPLDLLNSLGGSNIGKAQEEYGSTPEEIEFNKK SIAYKKHQNEVLKAKILVVRLVLILSLLFVYGRDFSLSLFTQTYAPNGSSFMRVFLTLEL IFQTSLFFFISKNKNFTDDSLISKLLNIGGAFIPATYRNLLQTASKYQVLLSMFLFDLSI VVVVFAIRAAFNF
Uniprot No.

Target Background

Function

Recombinant Pichia pastoris Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins possessing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Golgi to ER Traffic Protein 2 (GET2) and what is its function in Pichia pastoris?

GET2 in Pichia pastoris is a membrane protein involved in the retrograde transport pathway from the Golgi apparatus to the endoplasmic reticulum. It plays a critical role in maintaining cellular homeostasis by facilitating the retrieval of ER-resident proteins that have escaped to the Golgi. The full-length protein consists of 313 amino acids and is identified by UniProt accession number C4R3U0 . GET2 is part of a conserved membrane trafficking machinery that ensures proper protein sorting and quality control within the secretory pathway.

What expression systems are commonly used for recombinant GET2 production?

The most common expression systems for recombinant GET2 production include:

  • E. coli expression systems: Frequently used for producing N-terminal His-tagged GET2 protein. This approach allows for high-yield production but may require optimization for proper folding of membrane-associated proteins .

  • Native Pichia pastoris expression: Using vectors like pPICZ for intracellular expression or pPICZα for secreted expression under the control of the AOX1 promoter. This system is advantageous when studying GET2 in its native environment .

The choice of expression system depends on research objectives, with E. coli offering simpler cultivation requirements and P. pastoris providing more native-like post-translational modifications.

How can I verify the expression and functionality of recombinant GET2?

Verification of recombinant GET2 expression and functionality involves multiple complementary approaches:

  • SDS-PAGE analysis: Confirms the presence of the protein at the expected molecular weight (~34 kDa plus any fusion tags) .

  • Western blotting: Using either anti-His antibodies (for His-tagged constructs) or GET2-specific antibodies to verify protein identity .

  • Functional assays: Membrane incorporation assays or trafficking rescue experiments in GET2-deficient strains can confirm protein functionality.

  • Mass spectrometry: For detailed confirmation of protein sequence and post-translational modifications.

It is advisable to use multiple verification methods rather than relying solely on Coomassie staining, particularly for lower expression levels .

What strategies can optimize the expression yield of recombinant GET2 in Pichia pastoris?

Optimizing GET2 expression in P. pastoris requires a multifaceted approach:

  • Gene disruption strategy: Recent research has identified that disrupting specific genes in P. pastoris can significantly increase secretory production of target proteins. This approach involves creating multiple-gene disruption strains followed by serial cultivation to select high-producing variants .

  • Promoter selection: The AOX1 promoter provides strong, methanol-inducible expression, but constitutive promoters may be preferred depending on experimental needs .

  • Codon optimization: Adapting the GET2 coding sequence to P. pastoris codon usage bias can enhance expression efficiency.

  • Strain selection: Testing expression in multiple Pichia strains (X-33, GS115, SMD1168) can identify optimal hosts for GET2 production .

  • Induction parameters: Optimizing methanol concentration, temperature, pH, and induction duration significantly impacts expression yields.

ParameterRecommended RangeEffect on GET2 Expression
Temperature25-30°CLower temperatures may improve proper folding
Methanol0.5-1.0%Higher concentrations may be toxic
pH5.0-6.0Affects protein stability and secretion
Induction time48-96 hoursExtended induction may increase yield

How do mutations in GET2 affect protein trafficking in yeast cells?

Mutations in GET2 can have significant effects on protein trafficking pathways:

  • Transmembrane domain mutations: Alterations in the transmembrane regions (approximately residues 172-255) can disrupt membrane anchoring, preventing proper localization and function in the ER-Golgi interface.

  • Binding domain mutations: Modifications to regions that interact with other trafficking machinery components can impair protein retrieval mechanisms.

  • Phosphorylation site modifications: GET2 contains potential phosphorylation sites that, when mutated, may alter regulatory control of trafficking processes.

Experimental approaches to study these effects include site-directed mutagenesis followed by trafficking assays using fluorescently tagged cargo proteins. Quantitative analysis of mislocalized proteins in GET2 mutant strains can provide insights into the specific role of different protein domains.

What purification strategies are most effective for recombinant His-tagged GET2?

Purification of His-tagged GET2 requires specialized approaches due to its membrane-associated nature:

  • Detergent solubilization: Prior to purification, membrane fractions containing GET2 must be solubilized with appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) that maintain protein structure.

  • Immobilized metal affinity chromatography (IMAC): The polyhistidine tag binds divalent cations like Ni²⁺, allowing selective purification .

  • Size exclusion chromatography: As a secondary purification step to remove aggregates and achieve higher purity.

  • Buffer optimization: Including glycerol (10-20%) and specific lipids in purification buffers can maintain protein stability and function.

For membrane proteins like GET2, maintaining the native conformation during purification is critical, often necessitating the presence of detergents throughout the process to prevent aggregation.

How can I design experiments to study GET2 interactions with other trafficking proteins?

Studying GET2 interactions requires approaches that preserve protein-protein interactions while allowing their detection:

  • Co-immunoprecipitation assays: Using antibodies against tagged GET2 to pull down interaction partners, followed by mass spectrometry identification.

  • Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can identify direct protein interactions, though these may need adaptation for membrane proteins.

  • Bimolecular fluorescence complementation (BiFC): By fusing split fluorescent protein fragments to GET2 and potential partners, interactions can be visualized in vivo.

  • Proximity labeling: Technologies like BioID or APEX2 fused to GET2 can identify neighboring proteins in the cellular environment.

When designing these experiments, it's crucial to include appropriate controls, such as known interaction partners and non-interacting proteins, to validate the specificity of observed interactions.

What methods are available for studying the kinetics of GET2-mediated protein trafficking?

Kinetic analysis of GET2-mediated trafficking can be approached through several methodologies:

  • Pulse-chase experiments: Using radioactively or fluorescently labeled proteins to track their movement through compartments over time.

  • Live-cell imaging: Employing fluorescently tagged cargo proteins to visualize trafficking in real-time in GET2 wild-type versus mutant or knockout cells.

  • Subcellular fractionation time courses: Isolating cellular compartments at different time points after induction to quantify protein distribution.

  • Quantitative proteomics: SILAC or TMT labeling combined with mass spectrometry to measure protein abundance changes in different compartments over time.

Analysis of trafficking kinetics should account for cell-to-cell variability by collecting data from sufficient numbers of cells and applying appropriate statistical methods.

How can I troubleshoot poor expression of recombinant GET2 in Pichia pastoris?

When facing challenges with GET2 expression, consider this systematic troubleshooting approach:

  • Verify integration: Confirm proper genomic integration of your expression construct using PCR with AOX1 promoter-specific primers .

  • Check Mut phenotype: Determine if your transformants are Mut⁺ or Mut^S, as this affects methanol utilization and expression protocols .

  • Optimize induction: Test different methanol concentrations and feeding schedules, as overinduction can be toxic.

  • Screen multiple clones: Expression levels can vary significantly between transformants due to integration site effects; test 6-10 independent clones for each construct .

  • Examine for protein degradation: Include protease inhibitors and test protease-deficient strains (e.g., SMD1168).

  • Consider gene disruption strategies: Recent research shows that disrupting specific genes can significantly improve secretory production in P. pastoris .

Common IssuePotential Solution
No detectable expressionCheck construct integrity, try alternative promoters
Low expression levelScreen more clones, optimize media and induction parameters
Protein degradationUse protease-deficient strains, add protease inhibitors
Insoluble proteinModify culture conditions (lower temperature, slower induction)

How should I analyze contradictory results in GET2 localization studies?

When facing contradictory data regarding GET2 localization:

  • Evaluate methodology differences: Different detection methods (immunofluorescence, fractionation, GFP tagging) can yield varying results for membrane proteins.

  • Consider tag interference: N- or C-terminal tags may affect localization; compare results with differently tagged constructs and untagged proteins.

  • Assess cell growth conditions: GET2 localization may vary with growth phase or stress conditions.

  • Examine strain backgrounds: Different yeast strains may show subtle variations in protein trafficking pathways.

  • Quantitative analysis: Apply rigorous quantification to localization data rather than relying on qualitative assessments.

Resolving contradictory results often requires combining multiple orthogonal techniques to build a consistent model, potentially including both in vivo and in vitro approaches.

What statistical approaches are appropriate for quantifying GET2-dependent trafficking defects?

Rigorous statistical analysis of trafficking defects requires:

  • Appropriate sample sizing: Power analysis should determine the number of cells or samples needed for reliable detection of trafficking differences.

  • Normalization strategies: Account for variations in expression levels, cell size, or other confounding variables.

  • Statistical tests:

    • ANOVA for comparing multiple conditions

    • t-tests for pairwise comparisons

    • Non-parametric alternatives when normality cannot be assumed

  • Multiple testing correction: When analyzing many proteins or conditions simultaneously, adjust p-values using methods like Bonferroni or Benjamini-Hochberg.

  • Effect size reporting: Include measures like Cohen's d to quantify the magnitude of trafficking differences, not just statistical significance.

Robust analysis should include biological replicates (independent transformants) and technical replicates to account for experimental variability.

How can GET2 research contribute to improving recombinant protein production in Pichia pastoris?

Understanding GET2 function has significant implications for biotechnology applications:

  • Engineered secretion pathways: Modifying GET2 and related trafficking components can potentially enhance the secretion efficiency of valuable recombinant proteins .

  • Quality control improvements: GET2's role in retrieval pathways influences protein quality control, potentially reducing heterogeneity in recombinant products.

  • Strain development: Insights from GET2 research have contributed to the development of improved P. pastoris strains with enhanced secretory capabilities through strategic gene disruptions .

  • Process optimization: Understanding trafficking bottlenecks allows more rational design of fermentation and induction protocols.

Research shows that combining multiple gene disruptions in the secretory pathway, potentially including GET2-related modifications, followed by serial cultivation can significantly improve protein yields for various target proteins .

What are the latest methodological advances in studying membrane protein trafficking in yeast systems?

Recent technological developments have expanded research capabilities:

  • CRISPR-Cas9 genome editing: Enables precise modification of GET2 and related genes in P. pastoris, facilitating functional studies without marker genes.

  • Advanced microscopy techniques: Super-resolution microscopy and lattice light-sheet microscopy now allow visualization of trafficking events with unprecedented spatial and temporal resolution.

  • Synthetic biology approaches: Engineered trafficking circuits incorporating modified GET2 components can test mechanistic hypotheses and potentially improve protein production.

  • High-throughput screening platforms: Multi-well formatted assays enable rapid identification of genetic modifications that enhance protein secretion .

  • Computational modeling: Systems biology approaches now incorporate trafficking pathways to predict the effects of modifications to components like GET2.

These technologies collectively allow more comprehensive understanding of membrane protein trafficking dynamics and provide new tools for applied biotechnology research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.