Recombinant Pichia pastoris Peroxisomal biogenesis factor 2 (PEX2)

Shipped with Ice Packs
In Stock

Description

Overview of PEX2

  • Function: PEX2 is an integral peroxisomal membrane protein essential for peroxisome biogenesis and matrix protein import. Mutations in the PEX2 gene can lead to disorders like Zellweger syndrome and infantile Refsum disease .

  • Expression in Pichia pastoris: Pichia pastoris is a widely used expression system for recombinant proteins due to its ability to perform eukaryotic post-translational modifications and produce large quantities of protein .

Expression of Recombinant Proteins in Pichia pastoris

Pichia pastoris is favored for its ability to produce high yields of recombinant proteins with mammalian-like glycosylation patterns. This makes it an ideal host for expressing complex proteins, including membrane proteins and enzymes .

Advantages of Pichia pastoris

AdvantagesDescription
Post-Translational ModificationsPerforms eukaryotic-specific modifications similar to mammalian cells .
High Yield ProductionCan produce large quantities of recombinant proteins .
Cost-EffectiveInexpensive media and fast growth rate make it cost-effective .

Role of PEX2 in Peroxisomal Biogenesis

PEX2 is part of a ubiquitin ligase complex that functions as a retro-translocation channel for peroxisomal import receptors. This complex is crucial for the recycling of receptors involved in protein import into peroxisomes .

Mechanism of Action

  • Ubiquitin Ligase Complex: Comprises PEX2, PEX10, and PEX12, which facilitate receptor recycling by monoubiquitination .

  • Import and Recycling: Receptors import proteins into peroxisomes and must be recycled back to the cytosol for continuous import cycles .

Potential Applications of Recombinant PEX2

While specific applications of recombinant PEX2 in Pichia pastoris are not well-documented, its role in peroxisomal biogenesis suggests potential uses in studying peroxisomal disorders or developing therapeutic strategies.

Future Research Directions

  1. Disease Modeling: Recombinant PEX2 could be used to model peroxisomal disorders in vitro.

  2. Therapeutic Development: Understanding PEX2's function may aid in developing treatments for disorders related to peroxisomal biogenesis defects.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX2; PER6; Peroxisomal biogenesis factor 2; Peroxin-2; Peroxisomal protein PER6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Komagataella pastoris (Yeast) (Pichia pastoris)
Target Names
PEX2
Target Protein Sequence
MPNRLIPLANPANRVLQLDAKLLDNEISDMLYRQLSGAFNSNRLPSWLGRIHSNYASELK LLLELLIFKVTVWNKHSSYGLTLQNLVMYDGGVHNKKFRSKQQSELRVTKKILLLSSVLL GYFVKKIQSYVYSFEDYDLETDGEDLSTLERIRLKTIKLLKSQISTLEKAHSVLSLVNFV TFLVSGSFPDLTTRILNIRFKPLVTTQVAFASNPETISYEFQNRQLVWNTLTEFIVFILP ALSVPKFTKSLVSSITGTSPKSSQVTDEDLKVFSSLPERVCAICFQNSQNSDSGAQNDIS LNDTLVTNPYETTCGHIYCYVCILSKLQIFKEEGKNLPKSDPNKYWHCLRCNEPASWCRV YTGDVEDALRQKAVEEVTEDEDASSEDEEKRDQDSEGAKTVSQSFHHVNGSDYQTASFIE QAELNENEYTDGSEVEIYDAEDEYTDEEVDDDSPGFFVGAL
Uniprot No.

Target Background

Function

Essential for peroxisome biogenesis.

Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the role of PEX2 in peroxisome biogenesis in Pichia pastoris?

PEX2 is one of more than 20 PEX genes required for peroxisome biogenesis in eukaryotic cells, including Pichia pastoris. While the specific function of Pex2p remains less characterized compared to certain other peroxins, it is known to act upstream of peroxins like Pex4p, Pex22p, Pex1p, and Pex6p in the peroxisome biogenesis pathway . Pex2p likely functions after the docking of peroxisomal targeting signal (PTS) receptors but before the late stages of peroxisomal matrix protein import. In the broader peroxisome biogenesis framework, Pex2p works in conjunction with other peroxins to enable the formation of functional peroxisomes capable of importing both membrane and matrix proteins.

How does PEX2 differ from other peroxisomal biogenesis factors in P. pastoris?

PEX2 functions distinctly from other peroxins in P. pastoris. Unlike Pex3p (which is necessary for peroxisome membrane synthesis), Pex13p and Pex14p (which serve as docking factors for PTS receptors), or Pex8p, Pex10p, and Pex12p (which are required for translocation of proteins across the peroxisome membrane), Pex2p's precise mechanistic role remains to be fully elucidated . Epistasis analyses have demonstrated that Pex2p acts upstream of Pex4p, differentiating it from peroxins involved in later stages of protein import. Unlike Pex1p, Pex4p, Pex6p, and Pex22p mutants (which show reduced levels of the PTS1 receptor Pex5p), the effects of PEX2 mutations on Pex5p stability appear to be less pronounced, suggesting distinct functional roles.

What is the structure and topology of Pex2p in the peroxisomal membrane?

While the search results don't provide specific structural information about P. pastoris Pex2p, comparative analysis with other peroxins suggests it is likely an integral peroxisomal membrane protein with specific domains oriented toward the cytosol to facilitate interactions with other components of the peroxisome import machinery. Similar to other integral peroxisomal membrane proteins (PMPs), Pex2p would be synthesized in the cytosol and post-translationally delivered to peroxisomes . Precise determination of membrane topology would require experimental approaches such as protease protection assays coupled with immunodetection using domain-specific antibodies.

What are the optimal expression conditions for recombinant PEX2 in P. pastoris?

Optimizing expression of recombinant PEX2 in P. pastoris requires careful consideration of several factors:

  • Vector selection: For secretory expression, pPICZαA is a commonly used vector that contains the AOX1 promoter for methanol-inducible expression .

  • Kex2 P1' site optimization: The choice of amino acid at the Kex2 P1' site significantly influences secretory yields. Creating a library of constructs with different P1' residues and screening for optimal expression is recommended, as the impact of P1' residues varies between different proteins .

  • Genomic integration: Multiple integration of the expression cassette can enhance yield. Additionally, co-integration of extra copies of the KEX2 gene has been shown to significantly improve secretory productivity regardless of the P1' residue used .

  • Cultivation conditions: Optimize methanol concentration, temperature, pH, and feeding strategy during the induction phase based on experimental determination.

  • Strain selection: Consider using protease-deficient strains to minimize degradation of the recombinant protein.

How can I troubleshoot low expression levels of recombinant PEX2?

When encountering low expression levels of recombinant PEX2, consider the following systematic troubleshooting approach:

  • Verify correct integration: Confirm proper genomic integration of your expression construct using PCR analysis.

  • Optimize Kex2 P1' site: Test different amino acids at the P1' position as this can dramatically affect secretory yields. Creating a degenerative library at the P1' site can help identify the optimal residue for PEX2 expression .

  • Increase Kex2 levels: Introducing additional copies of Kex2 can significantly improve secretory productivity. Western blotting has confirmed increased Kex2 expression in host cells with additional integrated Kex2 copies, correlating with improved protein yields .

  • Assess protein folding: If PEX2 is misfolding, consider lowering the expression temperature or co-expressing chaperones to improve folding efficiency.

  • Evaluate protein toxicity: If PEX2 expression is toxic to the host, consider using an inducible promoter with tightly controlled expression.

  • Analyze for proteolytic degradation: Examine culture supernatants and cell lysates for degradation products using Western blotting.

How can I study the interaction network of Pex2p with other peroxins in P. pastoris?

Investigating Pex2p's interaction network requires sophisticated approaches:

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged Pex2p to pull down interacting proteins, followed by mass spectrometry identification. This can reveal both stable and transient interactions with other peroxins.

  • Yeast two-hybrid (Y2H) screening: Employ Y2H to systematically test binary interactions between Pex2p and other peroxins. This approach has successfully identified interactions between peroxins such as Pex17p and Pex19p .

  • Bimolecular fluorescence complementation (BiFC): Split fluorescent proteins fused to Pex2p and potential interaction partners can visualize interactions in vivo.

  • Epistasis analysis: Similar to studies with other peroxins, construct double mutants (e.g., pex2Δ combined with other pex mutants) to establish functional relationships in the peroxisome biogenesis pathway .

  • Proximity-dependent biotin labeling: Techniques like BioID or APEX2 fused to Pex2p can identify proximal proteins in the native cellular environment.

Table 1: Potential Pex2p interaction partners based on epistasis and functional studies in P. pastoris

PeroxinRelationship to Pex2pEvidence typeReference
Pex4pActs downstream of Pex2pEpistasis analysis
Pex10p, Pex12pPotential functional complexInferred from other organisms
Pex5pIndirect functional relationshipMatrix protein import pathway
Pex17pPotential interactionPeroxisome membrane organization

What are the consequences of PEX2 mutations on peroxisome biogenesis in P. pastoris?

The phenotypic consequences of PEX2 mutations can be analyzed through several approaches:

  • Morphological characterization: Electron microscopy analysis can reveal alterations in peroxisome structure, size, and abundance in pex2 mutants compared to wild-type cells.

  • Import assays: Fluorescently tagged peroxisomal matrix proteins (containing PTS1 or PTS2 signals) can be used to assess matrix protein import efficiency in pex2 mutants. Similarly, tagged PMPs can evaluate membrane protein localization.

  • Biochemical fractionation: Determining the distribution of peroxisomal proteins between membrane-associated and cytosolic fractions in pex2 mutants can reveal specific import defects.

  • Metabolic function assessment: Since peroxisomes are involved in specific metabolic pathways (e.g., β-oxidation of fatty acids), functional assays can assess the metabolic consequences of PEX2 mutations.

Unlike mutants in PEX4 and PEX22, which show severely reduced levels of the PTS1 receptor Pex5p, or mutants in PEX1 and PEX6, which show moderately reduced Pex5p levels, the specific effects of PEX2 mutations on Pex5p stability and other aspects of peroxisome function require detailed investigation .

What purification strategies are most effective for recombinant Pex2p from P. pastoris?

Purifying recombinant Pex2p presents challenges due to its membrane-bound nature. Consider these approaches:

  • Affinity tagging: Incorporate a purification tag (His6, FLAG, etc.) at either terminus of Pex2p, ensuring the tag doesn't interfere with protein function or localization.

  • Membrane protein extraction: Use appropriate detergents (e.g., digitonin, DDM, or CHAPS) to solubilize Pex2p from membrane fractions while maintaining protein integrity.

  • Two-step purification: Combine affinity chromatography with size exclusion or ion exchange chromatography to achieve higher purity.

  • On-column detergent exchange: If structural or functional studies are planned, consider exchanging harsh solubilization detergents with milder alternatives during purification.

  • Consideration of protein complexes: If Pex2p exists in complexes with other peroxins, tandem affinity purification may preserve these interactions for further studies.

How can I establish a reliable functional assay for recombinant Pex2p activity?

Developing functional assays for Pex2p requires understanding its role in peroxisome biogenesis:

  • Complementation assays: Express recombinant Pex2p variants in pex2Δ mutant strains and assess rescue of peroxisome biogenesis defects through:

    • Import of fluorescently tagged peroxisomal matrix proteins

    • Restoration of growth on carbon sources requiring peroxisomal metabolism

    • Ultrastructural analysis of peroxisome formation

  • In vitro reconstitution: If Pex2p has enzymatic activity (e.g., ubiquitin ligase activity suggested in some organisms), develop specific biochemical assays to measure this activity using purified components.

  • Interaction assays: Since Pex2p likely functions through interactions with other peroxins, quantitative binding assays (e.g., surface plasmon resonance) could serve as proxy measurements of functional activity.

  • Domain mapping: Systematic mutagenesis of Pex2p domains followed by functional testing can identify critical regions for activity and provide a basis for structure-function relationship studies.

How should I interpret conflicting data about PEX2 function across different model organisms?

When encountering contradictory findings regarding PEX2 function:

  • Consider evolutionary divergence: While the basic peroxisome biogenesis machinery is conserved, specific functions and interactions of peroxins can vary between organisms. For example, P. pastoris Pex17p shares only 18% identity with S. cerevisiae Pex17p despite functional similarities .

  • Experimental context matters: Different growth conditions, expression systems, and experimental approaches can yield apparently contradictory results. Standardize conditions when making cross-species comparisons.

  • Integration with epistasis data: Use epistatic relationships, such as those established for Pex2p acting upstream of Pex4p, to help resolve conflicting functional models .

  • Comparative analysis: Systematically compare phenotypes of pex2 mutants across species, looking for consistencies that may reveal core functions versus species-specific adaptations.

  • Direct testing in P. pastoris: When confronted with conflicting models from other organisms, directly test hypotheses in P. pastoris to establish species-specific functions.

What bioinformatic approaches can predict functional domains in Pex2p?

Several computational approaches can inform Pex2p structure-function analysis:

  • Sequence conservation analysis: Multiple sequence alignment of Pex2p homologs across species can identify conserved residues likely critical for function.

  • Domain prediction: Tools like SMART, Pfam, and InterPro can identify known functional domains, such as transmembrane regions or protein interaction motifs.

  • Secondary structure prediction: Algorithms like PSIPRED can predict secondary structural elements providing insights into protein folding.

  • Transmembrane topology prediction: TMHMM, TOPCONS, and similar tools can predict membrane-spanning regions and topology.

  • Protein-protein interaction sites: Tools like PIPE, GPS-Prot, or SPRINT can predict potential interaction interfaces.

  • 3D structure prediction: Modern tools like AlphaFold2 can generate predictive structural models even for membrane proteins, providing frameworks for hypothesis generation.

How can CRISPR-Cas9 gene editing advance PEX2 research in P. pastoris?

CRISPR-Cas9 technology offers several advantages for PEX2 research:

  • Precise genomic modifications: Create clean deletions, point mutations, or tagged versions of PEX2 at its native locus without introducing selection markers that might affect adjacent genes.

  • Multiplex editing: Simultaneously modify PEX2 and other peroxins to study genetic interactions and pathway relationships.

  • Inducible or conditional systems: Develop CRISPR interference (CRISPRi) or activation (CRISPRa) systems for conditional regulation of PEX2 expression.

  • High-throughput screening: Create libraries of PEX2 variants to systematically map functionally important residues.

  • Integration with imaging: Combine CRISPR-mediated tagging with advanced microscopy to track Pex2p dynamics in living cells.

What role might systems biology approaches play in understanding PEX2 function within the peroxisome biogenesis network?

Systems biology offers holistic perspectives on PEX2 function:

  • Network analysis: Construct protein-protein interaction networks centered on Pex2p to identify functional modules and predict pathway relationships.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from pex2 mutants to comprehensively map cellular consequences of PEX2 disruption.

  • Flux analysis: Quantify changes in metabolic pathways affected by peroxisome dysfunction to connect molecular defects to physiological outcomes.

  • Computational modeling: Develop mathematical models of peroxisome biogenesis incorporating known physical and genetic interactions among peroxins.

  • Evolutionary analysis: Compare the peroxisome biogenesis machinery across diverse species to identify core conserved functions versus lineage-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.