Recombinant Pichinde arenavirus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Description

Structure and Function

The wild-type PICV genome has two RNA segments, each encoding two genes in opposite orientations . The L segment encodes a matrix protein Z and an RNA polymerase L, while the S segment encodes the envelope glycoprotein GPC and the nucleoprotein NP .

The glycoprotein precursor (GPC) mediates receptor binding and virus-cell membrane fusion . By splitting the S segment into S1 and S2 segments, it is possible to insert an ORF of up to 2 kilobases in each segment .

Recombinant Pichinde Virus as a Vaccine Vector

Recombinant PICV has several features that make it an attractive viral vaccine vector :

  • Safety: rP18tri is attenuated in vitro and in vivo, causing a self-limiting infection in animals without adverse effects or shedding of the virus in blood or body fluids .

  • Low Seroprevalence: The low seroprevalence of PICV in human populations reduces concerns about pre-existing anti-vector immunity .

  • Strong Immune Responses: rP18tri induces strong immune responses, which further increase upon a homologous boost, and can be repeatedly administered without significantly decreasing vaccine immunity .

  • Targets Antigen-Presenting Cells: PICV targets antigen-presenting cells early in the infection, enhancing antigen presentation and increasing the frequency and avidity of specific adaptive immunity .

  • Versatile Administration: rP18tri can be given to mammalian host species through intramuscular, intraperitoneal, intranasal, and oral routes .

Applications in Vaccine Development

The rP18tri vector has been utilized to express antigens from other pathogens, such as Mycobacterium tuberculosis (Mtb), to develop new vaccine candidates . For example, the immunodominant Mtb antigens EsxH/TB10.4 and Ag85B have been expressed using rP18tri to evaluate antigen-specific CD8 and CD4 T cell responses . A P2A linker sequence can be used between two antigens to induce ribosomal skipping during translation, allowing the production of multiple proteins from one ORF, which may represent a strategy to generate rP18tri-based multivalent vaccines .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
274-503
Protein Length
Full Length of Mature Protein
Species
Pichinde mammarenavirus (PICV) (Pichind mammarenavirus)
Target Names
GPC
Target Protein Sequence
GFFTWDLSDSSGQHVPGGYCLEQWAIIWAGIKCFDNTVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNVENSLNLFKKTINGLISDSLVIRNSLKQLAKIPYCNYTKFWYINDTITGR HSLPQCWLVHNGSYLNETHFKNDWLWESQNLYNEMLMKEYEERQGKTPLALTDICFWSLV FYTITVFLHIVGIPTHRHIIGDGCPKPHRITRNSLCSCGYYKYQRNLTNG
Uniprot No.

Target Background

Function
This class I viral fusion protein mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. Membrane fusion is triggered by irreversible conformational changes upon endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide while also remaining a component of the GP complex. SSP is crucial for efficient glycoprotein expression, GP1/GP2 post-translational cleavage, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent cell fusion mediated by the glycoprotein. It also interacts with the host receptor.
Database Links

KEGG: vg:5075743

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Pichinde Arenavirus Pre-glycoprotein Polyprotein GP Complex (GPC)?

The Pichinde arenavirus pre-glycoprotein polyprotein GP complex (GPC) is the primary surface protein responsible for viral entry into host cells. It consists of three key components following post-translational processing: the stable signal peptide (SSP), the receptor-binding subunit GP1, and the transmembrane fusion subunit GP2. Unlike conventional signal peptides that are cleaved and degraded, the SSP of arenavirus GPC remains associated with the mature complex and plays crucial roles in GPC expression, processing, trafficking, and membrane fusion during viral entry .

The full-length mature protein spans amino acids 274-503 of the viral polyprotein and contains several conserved domains essential for viral function . The amino acid sequence includes critical regions involved in receptor binding, membrane fusion, and interactions with host cellular factors .

How Is Recombinant Pichinde Arenavirus GPC Typically Produced for Research Purposes?

Recombinant Pichinde arenavirus GPC is commonly produced using prokaryotic or eukaryotic expression systems depending on the research application. For structural studies and antibody production, E. coli expression systems are frequently employed, as they allow for high-yield production of protein fragments. According to available data, recombinant full-length Pichinde arenavirus GPC protein (amino acids 274-503) can be expressed in E. coli with an N-terminal His tag for purification purposes .

The methodology typically involves:

  • Cloning the GPC gene sequence into an appropriate expression vector (e.g., pCAGGS for mammalian expression or prokaryotic vectors for E. coli production)

  • Transforming the expression construct into the production host

  • Inducing protein expression under optimized conditions

  • Purifying the recombinant protein using affinity chromatography (often via His-tag)

  • Final purification and concentration steps, resulting in >90% pure protein as determined by SDS-PAGE

For functional studies requiring properly glycosylated and correctly folded GPC, mammalian expression systems such as 293T cells are preferred, as demonstrated in studies examining GPC processing and function .

What Is the Biological Significance of the Stable Signal Peptide (SSP) in the GPC Complex?

The stable signal peptide (SSP) of arenavirus GPC is unique among viral glycoproteins as it remains an integral component of the mature glycoprotein complex rather than being cleaved and degraded. This unusual characteristic makes it a critical factor in arenavirus biology with multiple essential functions:

  • GPC Processing and Maturation: The SSP guides the translocation of the nascent GPC into the endoplasmic reticulum and assists in proper folding and trafficking of the glycoprotein complex .

  • Membrane Fusion Facilitation: Research using the Pichinde virus reverse genetics system has revealed that the SSP plays a crucial role in the membrane fusion process during viral entry. Specifically, mutations at conserved residues such as K33, F49, and C57 completely abolished GPC-mediated cell entry, while the G2A mutation significantly reduced membrane fusion efficiency .

  • Viral Infectivity and Propagation: The SSP is essential for producing infectious virions, as demonstrated in experiments where mutations in highly conserved SSP residues prevented the generation of viable recombinant viruses .

Research using alanine substitution mutagenesis identified eight highly conserved residues within the SSP across 22 different arenaviruses: G2, Q3, N20, K33, N37, F49, R55, and C57 . These conserved residues are distributed across the N-terminal end, the two helical domains (h1 and h2), the loop region, and the C-terminal end of the SSP, highlighting its complex structural requirements for functionality.

Why Is Pichinde Virus Used as a Model for Studying Pathogenic Arenaviruses?

Pichinde virus (PICV) serves as an ideal model system for studying highly pathogenic arenaviruses for several significant reasons:

  • Biosafety Advantages: PICV is a non-pathogenic biosafety level 2 (BSL-2) agent, making it significantly safer and more accessible for laboratory research compared to hemorrhagic fever-causing arenaviruses like Lassa, Junin, and Machupo viruses, which require BSL-4 containment .

  • Guinea Pig Model Relevance: PICV infection in guinea pigs provides a well-characterized small animal model that mimics key aspects of Lassa fever pathogenesis. Low-passaged strains (P2) cause mild disease, while high-passaged strains (P18) cause severe Lassa fever-like illness with high mortality in guinea pigs .

  • Molecular Tools Availability: Researchers have developed infectious clones for both virulent and non-virulent strains of PICV, enabling detailed molecular characterization of virulence determinants . Additionally, recombinant PICV expressing reporter genes (such as luciferase) has been created for high-throughput screening applications .

  • Translational Value: Findings from PICV studies have proven valuable for understanding pathogenic arenavirus biology. For example, antiviral compounds identified using recombinant PICV systems have shown efficacy against laboratory strains of Lassa virus (LASV) and Junin virus (JUNV) .

  • Evolutionary Relevance: As a New World arenavirus, PICV shares structural and functional similarities with both Old World and New World pathogenic arenaviruses, making it a versatile model system .

The development of recombinant PICV reporter viruses has further enhanced its utility by enabling high-throughput screening of potential antiviral compounds under BSL-2 conditions, significantly accelerating drug discovery efforts against these deadly pathogens .

What Are the Optimal Storage and Handling Conditions for Recombinant Pichinde GPC Proteins?

Proper storage and handling of recombinant Pichinde virus GPC proteins are essential for maintaining structural integrity and biological activity. Based on established protocols, the following recommendations should be followed:

  • Long-term Storage: Store the lyophilized protein powder at -20°C to -80°C upon receipt. For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being optimal) and store in aliquots at -20°C to -80°C .

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to prevent freeze-thaw damage if long-term storage is needed

  • Buffer Conditions: The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

  • Avoiding Degradation: Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. Working aliquots can be stored at 4°C for up to one week, but longer periods require freezing with cryoprotectants .

  • Quality Control: Recombinant proteins should be checked for purity (typically >90% as determined by SDS-PAGE) before experimental use .

These conditions ensure optimal protein stability and activity for experimental applications ranging from structural studies to functional assays involving the GPC complex.

How Do Specific Mutations in the GPC Affect Viral Entry and Pathogenesis?

  • SSP Domain Mutations:

    • K33A, F49A, and C57A mutations: These substitutions completely abolished GPC-mediated cell entry and prevented generation of viable recombinant viruses, demonstrating their essential role in the viral life cycle .

    • G2A mutation: This substitution caused a marked reduction in membrane fusion efficiency. Although recombinant virus with this mutation remained viable, it was significantly attenuated both in cell culture and in guinea pig infection models .

  • Guinea Pig-Adapted Strain Variations:

    • Serial passage of Pichinde virus in guinea pigs introduces specific mutations in the GPC that correlate with increased virulence. Missense mutations at codons GPC-119, GPC-140, and GPC-164 were strongly associated with virulence in guinea pig models .

    • The mutation at codon GPC-140 is particularly notable as it occurs in a region of peak hydrophilicity of GP1, potentially altering B cell epitopes or virus attachment protein conformation .

  • Structural Implications:
    The distribution of critical residues across different domains of the GPC complex indicates that multiple regions cooperate functionally during the viral entry process:

    • The SSP interacts with the GP2 fusion subunit to regulate pH-dependent membrane fusion

    • Mutations in GP1 can affect receptor recognition and binding affinity

    • Changes in the cleavage site between GP1 and GP2 can alter processing efficiency and fusion competence

These findings provide valuable insights for understanding arenavirus entry mechanisms and highlight potential targets for antiviral intervention. The attenuation observed with specific mutations also offers promising directions for rational vaccine design against pathogenic arenaviruses.

What Experimental Approaches Can Be Used to Study GPC-Mediated Membrane Fusion?

Investigating GPC-mediated membrane fusion requires specialized experimental approaches that address the unique attributes of arenavirus entry. Several methodologies have proven effective:

  • Cell-Cell Fusion Assays:
    Researchers can transfect cells with wild-type or mutant GPC expression vectors (e.g., pCAGGS-PICV-GPC) and trigger fusion by acidic pH treatment. Fusion events are quantified through:

    • Multinucleated syncytia formation observed by microscopy

    • Reporter gene activation when cells containing split reporters fuse

    • This approach was successfully used to characterize the effects of SSP mutations (like G2A, K33A, F49A, and C57A) on fusion capacity

  • Pseudotyped Virus Systems:

    • Generation of retroviral or vesicular stomatitis virus (VSV) particles pseudotyped with wild-type or mutant Pichinde GPC

    • These systems allow for quantitative assessment of entry efficiency using luciferase or GFP reporters

    • Entry inhibition studies can be performed by treating pseudotyped particles with antibodies, peptides, or small molecules

  • Recombinant Virus Approaches:

    • Creation of recombinant Pichinde viruses carrying specific GPC mutations using reverse genetics systems

    • Assessment of viral entry efficiency in cell culture through measurement of viral RNA synthesis, protein expression, or reporter gene activity

    • In vivo evaluation of mutant virus pathogenesis in guinea pig models

  • Biochemical Characterization:

    • Monitoring conformational changes in GPC using conformation-specific antibodies

    • Protease sensitivity assays to detect fusion-associated structural rearrangements

    • Protein crosslinking studies to identify critical interactions during the fusion process

These complementary approaches have revealed that the SSP domain plays essential roles in both GPC processing and the membrane fusion process. For example, studies revealed that mutations at K33, F49, and C57 abolished GPC-mediated cell entry, while the G2A mutation specifically impaired the membrane fusion step without affecting GPC expression or processing .

How Does the Recombinant Pichinde Reporter Virus System Facilitate Antiviral Drug Screening?

The recombinant Pichinde virus (rPICV) reporter system represents a significant advancement in arenavirus research, particularly for antiviral drug discovery. This system offers several advantages for high-throughput screening (HTS) of potential inhibitors:

  • BSL-2 Compatibility:

    • rPICV is non-pathogenic and can be handled in standard BSL-2 laboratories, eliminating the need for high-containment facilities required for pathogenic arenaviruses (BSL-3/4)

    • This accessibility significantly accelerates the screening process and reduces costs

  • Reporter Gene Integration:

    • rPICV has been engineered to express firefly luciferase, providing a quantitative readout of viral replication

    • Luciferase expression correlates proportionally with infection rate, allowing for sensitive detection of antiviral activity

  • High-Throughput Optimization:
    The system has been specifically optimized for 384-well format screening with:

    • Robust Z' scores indicating excellent assay quality

    • High signal-to-background ratios for clear distinction between hits and non-hits

    • Low intrinsic variance ensuring reproducibility across screening plates

  • Validation Against Pathogenic Arenaviruses:

    • Compounds identified using the rPICV system can be validated against other arenaviruses including:

      • Recombinant lymphocytic choriomeningitis virus (rLCMV)

      • Laboratory strains of Lassa virus (Josiah) and Junin virus (Romero)

    • This validation process confirms broad-spectrum activity against clinically relevant arenaviruses

  • Successful Implementation:
    The utility of this approach has been demonstrated through the identification of several hit compounds, including ribavirin (a known inhibitor of arenaviral RNA synthesis), all showing good potency and selectivity against rPICV replication .

This methodological approach represents a significant advancement in arenavirus drug discovery, providing a safe, efficient, and reliable platform for identifying broad-spectrum inhibitors of highly pathogenic arenaviruses under standard laboratory conditions.

What Are the Key Conserved Residues in the SSP Domain and How Do They Impact GPC Function?

The stable signal peptide (SSP) of arenavirus GPC contains several highly conserved residues that play critical roles in the structure and function of the glycoprotein complex. Comparative analysis of 22 different arenavirus species has identified eight residues that are either completely or highly conserved across the family:

  • Distribution of Conserved Residues:

    • N-terminal end: G2, Q3

    • h1 domain: N20

    • Loop region: K33

    • h2 domain: N37, F49

    • C-terminal end: R55, C57

  • Functional Significance Based on Mutational Analysis:

    Conserved ResidueLocationEffect of Alanine SubstitutionFunctional Implication
    G2N-terminusReduced membrane fusion; viable but attenuated virusCritical for fusion process
    K33Loop regionAbolished GPC-mediated cell entry; no viable virusEssential for viral life cycle
    F49h2 domainAbolished GPC-mediated cell entry; no viable virusEssential for viral life cycle
    C57C-terminusAbolished GPC-mediated cell entry; no viable virusEssential for viral life cycle
  • Structural Implications:

    • The SSP forms a hairpin-like structure with two transmembrane domains (h1 and h2) connected by a short ectodomain loop

    • Conserved residues in the transmembrane domains (like F49) likely mediate critical interactions with GP2 during the fusion process

    • The terminal residues (particularly C57) may be involved in interactions that stabilize the mature GPC complex

  • Mechanistic Roles:

    • The K33 residue in the loop region may interact with host cell receptors or influence pH sensing during endosomal trafficking

    • The C57 residue at the C-terminus has been implicated in zinc coordination and interactions with the membrane-proximal external region of GP2

    • The G2 residue appears specifically involved in the membrane fusion step rather than in GPC expression or processing

These findings highlight the multifunctional nature of the SSP in GPC biology and identify specific residues that could serve as targets for broad-spectrum antiviral development against pathogenic arenaviruses.

How Do Guinea Pig-Passaged Pichinde Virus Variants Differ in Their GPC Sequence and Virulence?

The guinea pig model of Pichinde virus (PICV) infection represents a valuable system for studying arenavirus pathogenesis. Sequential passage of PICV through guinea pigs generates variants with enhanced virulence that mimic aspects of human Lassa fever. Detailed sequence analysis has revealed key differences between attenuated and virulent strains:

  • GPC Mutations Associated with Virulence:
    Comparison of low-passage (attenuated) and high-passage (virulent) variants of the PICV Munchique strain (CoAn 4763) identified several missense mutations strongly associated with increased virulence:

    • Mutations at codons GPC-119, GPC-140, and GPC-164 in the glycoprotein precursor gene

    • Of these, the mutation at codon GPC-140 is particularly significant as it occurs in a region of peak hydrophilicity of GP1

  • Functional Implications:

    • The GPC-140 mutation may alter B cell epitopes, potentially affecting antibody recognition and immune evasion

    • Alternatively, this mutation could influence virus attachment protein conformation, affecting receptor binding or fusion triggering

    • These changes likely contribute to the enhanced virulence observed in guinea pig models

  • Pathological Consequences:
    Guinea pigs infected with virulent, high-passage PICV variants develop a disease that closely resembles human Lassa fever, characterized by:

    • Fever

    • Leukopenia

    • Thrombocytopenia

    • Platelet dysfunction

    • Terminal vascular collapse in the absence of significant hemorrhagic manifestations

  • Additional Genetic Determinants:
    Besides GPC mutations, changes in the nucleoprotein (NP) gene also contribute to virulence:

    • Mutations at codons NP-35 and NP-374 were associated with increased pathogenicity

    • These sites may affect NP's role in viral RNA synthesis or its interferon-suppressing function via the exoribonuclease domain

This guinea pig adaptation model provides valuable insights into the molecular determinants of arenavirus virulence and offers opportunities to study potential therapeutic interventions before testing in models of highly pathogenic human arenavirus infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.