Recombinant Picrophilus torridus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Cobalamin Synthase (cobS) Functional Role

CobS catalyzes the adenosylation of cobinamide to form adenosylcobalamin, a coenzyme essential for methionine synthesis and carbon rearrangement reactions. In Escherichia coli, cobS functions as a cobalamin-5'-phosphate synthase with a conserved GDP-binding domain critical for substrate recognition . While P. torridus’s genome (1.55 Mb, 92% coding density) encodes metabolic pathways for amino acid degradation and DNA repair , its cobalamin biosynthesis machinery remains uncharacterized.

Recombinant cobS Expression Systems

Recombinant cobS is typically expressed in heterologous hosts such as E. coli or yeast for high-yield production . For example:

FeatureE. coli cobS (B5YSS1) Recombinant Protein
HostE. coli expression system
TagN-terminal His-tag
Length247 amino acids (full length)
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer, 6% trehalose
ActivityAdenosylcobinamide-GDP ribazoletransferase

Insect or mammalian cell systems may enable post-translational modifications absent in prokaryotic hosts , though no studies confirm this for P. torridus cobS.

torridus Genomic and Enzymatic Context

P. torridus thrives at pH 0.7 and 60°C, maintaining an intracellular pH of ~4.6 . Its genome lacks explicit cobS annotation but encodes:

  • DNA replication machinery: MCM helicase and GINS complex, activated under acidic conditions .

  • DNA methylation: Type I restriction-modification systems with adenine-specific methylase activity .

  • Secreted proteins: Oxidoreductases, peptidases, and ion-binding proteins linked to acid adaptation .

The absence of cobS data suggests either unannotated homologs or reliance on environmental cobalamin uptake.

Research Implications

The expression of P. torridus cobS would require:

  1. Gene identification: Mining its genome for cobS homologs using E. coli or archaeal sequences.

  2. Acid-stable expression: Leveraging P. torridus’s native promoters or acid-tolerant hosts (e.g., Sulfolobus spp.).

  3. Activity assays: Validating function under extreme pH and temperature via ATP hydrolysis or cobalamin quantification.

Comparative Analysis of Recombinant cobS

ParameterE. coli cobS Hypothetical P. torridus cobS
Optimal pHNeutralAcidic (pH 0.7–4.6)
ThermostabilityModerate (mesophilic)High (thermoacidophilic)
Host SystemsE. coli, yeast Archaeal or acid-adapted vectors

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; PTO0693; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)
Target Names
cobS
Target Protein Sequence
MQGLKSAISFFTIIPVKADLNKNIVFFFTITGAITGLMAASIFYLTSFINQLLASVASVS FLIIIYGFNHADAVLDLGDTFMVHDPEKKKIIIKDVYHGTGSVVTFFIIYIITISLLSSF NSIQGSIALILSETISRFSMLMSMYKSNSFSGGISEIFISYFDKPFKITFFNFLVIILIF LIFYKYIIFTMFSLISIVISYYFKSHEQKIFNGINGDIIGFTGELSRLISLLLILISFKL I
Uniprot No.

Target Background

Function
Recombinant Picrophilus torridus Cobalamin synthase (cobS) catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: pto:PTO0693

STRING: 263820.PTO0693

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Picrophilus torridus and why is it significant for studying CobS?

Picrophilus torridus is an extremophilic archaeon with exceptional acid tolerance, capable of growth at pH values as low as 0 and temperatures around 60°C. Its genome consists of a 1,545,900-bp circular chromosome with 1,535 ORFs and remarkably high coding density (91.7%), the highest among thermoacidophiles . P. torridus is significant for CobS research because it represents an opportunity to study cobalamin biosynthesis under extreme conditions, potentially revealing adaptations in membrane proteins like CobS that function under high proton gradients.

What is the role of CobS in cobalamin biosynthesis?

Cobalamin synthase (CobS) catalyzes the penultimate step in the biosynthesis of adenosylcobamide (AdoCbl, a form of vitamin B12). Specifically, it performs the condensation of an activated corrin ring with an activated lower ligand base, a critical convergence point in the pathway . This reaction is part of the "late steps" of cobalamin biosynthesis, which are responsible for nucleotide loop assembly. While CobS catalyzes the formation of adenosylcobamide phosphate (AdoCbl-P), the CobC enzyme subsequently removes the phosphate to yield the final AdoCbl product . CobS homologs are found in all cobamide-producing bacteria and archaea sequenced to date, suggesting the evolutionary conservation of this membrane-associated enzymatic step.

How does the acidophilic lifestyle of P. torridus potentially influence CobS function?

P. torridus relies heavily on a high proton gradient across its membrane for energy generation and transport processes. The genome sequence reveals an unusually high ratio of secondary transporters to ABC transporters (11:1) compared to other microorganisms, indicating extensive utilization of the proton motive force (PMF) for transport functions . Given that CobS is an integral membrane protein and research on other organisms shows CobS activity can affect membrane integrity and PMF , P. torridus CobS likely evolved specific adaptations to function optimally under extreme acid conditions while maintaining membrane stability.

What genomic features of P. torridus are relevant to CobS research?

The P. torridus genome encodes 1,535 ORFs with an impressive 92% coding density. The G+C content is 36%, which is relatively low . The genome contains the necessary genetic machinery for various DNA repair and recombination processes, which is important when considering genetic manipulation for CobS studies. While the search results don't specifically mention the CobS gene in P. torridus, the genome contains numerous transport systems that rely on the proton motive force, which is relevant to CobS function since studies in other organisms show CobS can affect membrane integrity and PMF .

How does P. torridus CobS compare to CobS enzymes from other organisms?

While the search results don't provide direct comparative data for P. torridus CobS, we can infer from general genomic comparisons that P. torridus shares homologs with both Thermoplasma acidophilum and Sulfolobus solfataricus, but fewer with Pyrococcus furiosus . This suggests that ecological closeness (adaptation to acidic environments) may override phylogenetic relatedness in some protein conservation patterns. CobS from various organisms is consistently described as a polytopic integral membrane protein that catalyzes the penultimate step of the AdoCbl biosynthesis pathway , indicating functional conservation despite environmental differences.

What are the known structural features of CobS proteins?

CobS is characterized as a polytopic integral membrane protein with multiple transmembrane domains . Research on Salmonella CobS has shown that it integrates into the inner membrane and functions within this environment. While the search results don't provide specific structural data for P. torridus CobS, studies on other CobS enzymes indicate they contain critical residues essential for catalytic function, such as the D82 residue identified in Salmonella CobS . The membrane association of CobS is conserved across all known cobamide producers, suggesting this localization is functionally significant .

What challenges are associated with heterologous expression of P. torridus CobS?

Expressing P. torridus CobS presents several challenges characteristic of both extremophilic proteins and membrane proteins:

  • Membrane protein expression: Research on Salmonella CobS revealed that overproduction impairs cell growth and triggers phage shock protein A (PspA) production, indicating membrane stress . Similarly, P. torridus CobS expression likely disrupts host cell membranes.

  • Effects on cell viability: High levels of CobS expression in E. coli dissipate the proton motive force, decrease membrane stability, arrest growth, and ultimately kill the cell . Researchers must carefully balance expression levels to avoid these detrimental effects.

  • Protein folding at non-native pH and temperature: P. torridus proteins are adapted to function at extremely low pH and elevated temperatures, conditions that cannot be replicated in most expression hosts.

A methodological approach would include:

  • Using controlled induction systems with tunable expression levels

  • Co-expressing with stabilizing factors like PspA or CobC, which have been shown to counteract the negative effects of CobS overproduction

  • Employing specialized E. coli strains designed for membrane protein expression

  • Testing various solubilization and purification strategies optimized for membrane proteins

What purification strategies are most effective for recombinant P. torridus CobS?

Based on breakthroughs reported for Salmonella CobS purification , an effective strategy would include:

  • Controlled membrane extraction: Use detergents suitable for maintaining the structural integrity of extremophilic membrane proteins. The protocol for Salmonella CobS achieved 96% homogenous protein .

  • Liposome reconstitution: After purification, reconstitute P. torridus CobS into liposomes to provide a lipid bilayer environment that supports proper folding and function .

  • Stability optimization: Include appropriate stabilizers during purification to protect the protein from denaturation outside its native acidic environment.

  • Activity verification: Develop assays to confirm that the purified protein retains its catalytic function, possibly adapting substrate binding analyses similar to those used for Salmonella CobS .

The purification protocol should be tailored to the unique properties of P. torridus proteins, particularly their stability requirements at low pH and high temperature.

How can researchers assess the enzymatic activity of recombinant P. torridus CobS?

A comprehensive approach to assessing P. torridus CobS activity would include:

  • In vitro reconstitution assays: Measure the condensation of activated corrin ring and lower ligand base substrates to form adenosylcobamide phosphate. This would require:

    • Preparation of purified substrates (activated corrin ring and activated lower ligand base)

    • Reconstitution of purified CobS into liposomes to provide a membrane environment

    • Optimized reaction conditions mimicking P. torridus cytoplasmic conditions (pH, temperature, salt)

    • HPLC or mass spectrometry analysis to detect the AdoCbl-P product

  • Membrane integrity assays: Since CobS affects membrane properties, monitor:

    • Effects on proton motive force using dyes like ethidium bromide accumulation

    • Membrane permeability using indicators like TO-PRO-3

    • Membrane potential using dyes like 3,3′-diethyloxacarbocyanine iodide

  • Substrate binding analysis: Adapt the in vitro substrate binding methods reported for Salmonella CobS to evaluate P. torridus CobS-substrate interactions under varying pH and temperature conditions.

What is known about the relationship between CobS and the proton motive force?

Research on Salmonella CobS has demonstrated that elevated levels of CobS negatively affect the proton motive force, cell membrane permeability, and viability . Specific findings include:

  • PMF dissipation: Cells overexpressing CobS showed increased ethidium bromide accumulation, indicating disruption of the proton gradient .

  • Increased membrane permeability: CobS overproduction led to significantly higher uptake of TO-PRO-3, demonstrating compromised membrane integrity .

  • Cell division effects: CobS-synthesizing cells exhibited elongation and lacked divisional septa, suggesting that membrane depolarization interferes with proper localization of the divisome .

  • Counteracting factors: Coexpression of CobC (the phosphatase catalyzing the final step of the pathway) or PspA (phage shock protein) ameliorated these detrimental effects .

For P. torridus CobS, these relationships may be particularly significant given the organism's reliance on PMF for numerous cellular processes, as indicated by its high ratio of secondary transporters to ABC transporters (11:1) .

How does pH affect the stability and activity of P. torridus CobS?

While the search results don't provide specific data on P. torridus CobS pH preferences, several considerations are relevant based on the organism's physiology:

  • Native environment: P. torridus grows optimally at pH 0.7 and 60°C, suggesting its proteins, including CobS, are adapted to function under extremely acidic conditions .

  • Membrane protein adaptation: As an integral membrane protein in an acidophile, P. torridus CobS likely has structural features that stabilize it within the membrane despite the high proton concentration gradient.

  • Experimental approach: Researchers should:

    • Test CobS activity across a pH gradient (0-7) to determine optimal conditions

    • Compare activity in different buffer systems that maintain stability at extremely low pH

    • Evaluate structural changes using circular dichroism spectroscopy at varying pH

    • Assess the impact of pH on substrate binding affinity

Since P. torridus maintains a more neutral internal pH despite growing in extremely acidic environments, understanding whether CobS functions optimally at the external pH or cytoplasmic pH is crucial for experimental design.

How might a multienzyme complex involving CobS function in P. torridus?

Research suggests that the late steps of cobamide biosynthesis are catalyzed by a multienzyme complex associated with the cell membrane, involving CbiB, CobU, CobT, CobC, and CobS . In P. torridus, this complex would need to function under extreme acidic conditions.

A methodological investigation would include:

  • Protein-protein interaction studies:

    • Pull-down assays with tagged P. torridus CobS to identify interacting partners

    • Crosslinking experiments to capture transient interactions

    • Bacterial two-hybrid systems adapted for extremophilic proteins

  • Membrane localization studies:

    • Fluorescent tagging to visualize the complex in vivo

    • Membrane fractionation to isolate intact complexes

    • Cryo-electron microscopy to visualize the complex architecture

  • Functional reconstitution:

    • Co-expression of multiple components (e.g., CobS with CobC)

    • Reconstitution into liposomes to test coordinated activity

    • Analysis of substrate channeling between enzymes

The search results show that CobC can counteract negative effects of CobS overproduction and CobC association with liposomes depends on CobS presence , providing evidence for functional interactions that may be conserved in P. torridus.

What adaptations might P. torridus CobS exhibit for functioning in extreme acid?

Given P. torridus's extreme acidophilic lifestyle, its CobS likely possesses unique adaptations:

  • Structural stabilization mechanisms:

    • Increased hydrophobicity in membrane-spanning regions

    • Modified surface charge distribution to handle proton flux

    • Potentially unique transmembrane domain arrangements

  • Substrate binding adaptations:

    • Altered substrate recognition sites for functioning at low pH

    • Potentially modified catalytic mechanisms for acid stability

  • Interaction with proton gradients:

    • Specialized mechanisms to maintain function despite the organism's reliance on PMF

    • Potential coordination with P. torridus's abundant secondary transporters

Investigation approaches:

  • Comparative analysis with CobS from neutrophilic organisms

  • Site-directed mutagenesis of charged residues

  • pH-dependent activity and binding assays

  • Molecular dynamics simulations under varying pH conditions

How does the membrane association of CobS relate to its function in cobamide biosynthesis?

The membrane association of CobS is conserved across all cobamide producers, raising important questions about this localization . Several hypotheses could be tested:

  • Substrate accessibility: The membrane may serve as a scaffold that positions CobS optimally relative to its substrates.

  • PMF utilization: CobS might harness the proton gradient for catalysis, which would be particularly relevant in P. torridus given its high reliance on PMF .

  • Product channeling: Membrane localization may facilitate direct transfer of intermediates between enzymes in the cobamide synthesis pathway.

  • Protection of reactive intermediates: The membrane environment may shield unstable cobamide precursors from degradation.

Research approaches:

  • Creation of soluble CobS variants to test the necessity of membrane association

  • Liposome reconstitution with varying lipid compositions

  • Investigation of CobS activity with artificial proton gradients

  • Co-localization studies with other cobamide biosynthesis enzymes

What controls should be included when studying P. torridus CobS expression and function?

Based on research with other CobS proteins, essential controls include:

  • Catalytically inactive variants: Create mutations in predicted catalytic residues (similar to the D82A mutation in Salmonella CobS ) to distinguish between functional effects and physical membrane disruption.

  • Expression level controls:

    • Empty vector controls

    • Varying induction conditions to control expression levels

    • Western blots to quantify protein levels

  • Membrane integrity markers:

    • EtBr accumulation assays to monitor PMF

    • TO-PRO-3 uptake to assess membrane permeability

    • DiOC2 staining to evaluate membrane potential

  • Cell viability measurements:

    • Growth curves

    • Colony forming unit counts

    • Microscopy to observe cell morphology changes

  • Co-expression partners:

    • CobC co-expression to mitigate negative effects

    • PspA co-expression as another mitigating factor

How can researchers investigate the interaction between P. torridus CobS and CobC?

Evidence suggests important functional interactions between CobS and CobC, with CobC potentially counteracting negative effects of CobS overproduction and CobC association with liposomes depending on CobS presence . Investigation approaches include:

  • Co-immunoprecipitation: Using tagged versions of P. torridus CobS and CobC to detect physical interactions.

  • Functional complementation:

    • Express both proteins in varying ratios

    • Monitor the effects on membrane integrity and cell viability

    • Measure enzymatic activity of the complex compared to individual proteins

  • Liposome reconstitution studies:

    • Incorporate purified CobS into liposomes

    • Assess CobC association with these liposomes

    • Perform activity assays with the reconstituted complex

  • Structural studies:

    • Crosslinking experiments to capture the complex

    • Membrane protein crystallization techniques

    • Cryo-electron microscopy of the reconstituted complex

What methodological approaches can address the challenges of working with extremophilic membrane proteins?

Working with P. torridus CobS requires specialized approaches:

  • Expression optimization:

    • Temperature-inducible systems to control expression rates

    • Specialized E. coli strains for toxic membrane proteins

    • Co-expression with stabilizing factors like PspA

  • Purification strategies:

    • Gentle solubilization methods preserving native structure

    • Purification under acidic conditions mimicking native environment

    • Use of detergents optimized for extremophilic membrane proteins

  • Activity assays:

    • Development of assays functioning at low pH and high temperature

    • Liposome reconstitution with acid-stable lipids

    • Adaptation of enzyme kinetics methods for extreme conditions

  • Structural analysis:

    • Acid-stable fluorescent tags for localization studies

    • Modifications to traditional structural biology techniques for acidophilic proteins

    • Computational modeling incorporating extremophilic parameters

ParameterTypical CobS ResearchAdaptations for P. torridus CobS
pH rangeNeutral (6.5-7.5)Acidic (0.7-3.0)
Temperature30-37°C55-65°C
Expression systemStandard E. coliTemp-regulated, co-expression with stabilizers
Membrane mimeticsStandard phospholipidsAcid-stable lipid compositions
Activity assaysStandard conditionsModified for extreme pH and temperature
Interaction studiesStandard pull-downsAcid-stable tags and buffers

How can researchers assess the impact of P. torridus CobS on the proton motive force?

Based on methodologies used with Salmonella CobS , researchers can:

  • Measure ethidium bromide accumulation:

    • EtBr uptake increases when PMF is dissipated

    • Compare accumulation rates in cells expressing P. torridus CobS versus controls

    • Test effects of different expression levels

  • Assess membrane permeability:

    • Use TO-PRO-3 uptake assays to evaluate membrane integrity

    • Monitor changes over time after CobS induction

    • Compare wild-type CobS with catalytically inactive variants

  • Evaluate membrane potential:

    • Use carbocyanine dyes like DiOC2 to visualize potential changes

    • Perform flow cytometry to quantify membrane potential across cell populations

    • Correlate with CobS expression levels

  • Test mitigating factors:

    • Co-express with CobC or PspA

    • Measure the degree of protection provided

    • Determine optimal expression ratios

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.