Recombinant Picrophilus torridus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format preference, kindly indicate your requirement during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
As a standard practice, all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own applications.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles to maintain product integrity.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; PTO0160; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)
Target Names
htpX
Target Protein Sequence
MDLYSIKLKVITILAGIGIALLFSLIAYGLLYYFYGLSGISIIYFLLIFVLFIDIIQWLV SPYIIGMTYRLQKVSPMSQYGYLIDIVHDAAEKNNIKEPEVYIAMRGSPNAFAYSSPLAG KRIAFTKSILDILNRDELEAVAGHELGHLKHHDVELLLAIGLIPTLIFYLGYSMIFSGFG RRNGGSFFLVAIILFILSSVFNIMILGVNRIRESYADVNSAMTIPNGAENLQNALAKIYS YSMPSKQTSNSTVNMLMFSDHIENDLGRDYRKLVEKWKNMKPPVSIFSDHPHPAKRIQIL ERYKNSF
Uniprot No.

Target Background

Database Links

KEGG: pto:PTO0160

STRING: 263820.PTO0160

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HtpX from Picrophilus torridus and what makes it scientifically significant?

HtpX from Picrophilus torridus is a heat shock, membrane-bound zinc metalloprotease belonging to the M48 family of peptidases. It contains the conserved motif HEXXH, which forms part of the metal binding site essential for its catalytic activity . The protein is significant for several reasons:

  • It displays remarkable thermal and acid stability, reflecting its origin from P. torridus, which is the most acidophilic organism known, capable of growing at pH 0 and temperatures up to 65°C

  • It possesses the unusual ability to cleave itself autocatalytically in the presence of Zn²⁺, which functions as a divalent cation that helps in the activation of water molecules

  • It represents an important model for studying extremozymes with potential biotechnological applications

  • It offers insights into protein adaptation mechanisms in extreme environments

The protein primarily consists of two transmembrane segments, with a small N-terminal domain and a larger C-terminal domain containing two hydrophobic regions for membrane interaction .

What is the structural organization of P. torridus HtpX and how does it compare to homologs from other organisms?

P. torridus HtpX possesses a distinctive structural organization:

  • The full protein is 307 amino acids in length

  • It consists of two transmembrane segments that anchor it to the membrane

  • It contains a small N-terminal domain and a larger C-terminal domain with two hydrophobic regions for membrane interaction

  • The active site is located on the cytoplasmic side of the cytoplasmic membrane

  • It contains the conserved HEXXH motif that coordinates zinc in the active site

Compared to homologs from other organisms:

  • P. torridus HtpX has very little sequence similarity with structurally characterized homologs from Saccharomyces mikatae (PDB: 4IL3) and Vibrio parahaemolyticus (PDB: 3CQB)

  • The crystal structure of V. parahaemolyticus HtpX domain (PDB: 3CQB) shows it belongs to the M48 family of metalloproteases

  • Unlike mesophilic homologs, P. torridus HtpX has adaptations for extreme acidity and high temperature

Due to the limited sequence similarity, structural modeling of P. torridus HtpX has been performed using tools like Phyre2 with the S. mikatae structure as a template .

What are the optimal expression systems and conditions for producing recombinant P. torridus HtpX?

Based on research findings, the following expression strategies have proven effective:

Expression Systems:

  • E. coli-based expression systems have been successfully used for recombinant expression of HtpX homologs

  • For P. torridus proteins, E. coli BL21 codon plus (DE3)-RIL cells have shown good results with pET vector systems (similar to approaches used for other P. torridus proteins)

Expression Conditions:

  • Lower temperatures (20°C) may improve proper folding and reduce inclusion body formation, as demonstrated for other P. torridus recombinant proteins

  • Induction with 0.4 mM IPTG has been effective for P. torridus proteins

  • Growth in Luria-Bertani medium, followed by harvest after 16 hours of expression, has yielded functional proteins

Critical Considerations:

  • Adding zinc during expression may be counterproductive as it can trigger autocatalytic degradation during expression

  • For functional expression, refolding in the presence of a zinc chelator followed by controlled addition of Zn²⁺ may be necessary to prevent premature self-cleavage

  • Heat treatment (60°C) post-expression can be used as an initial purification step, taking advantage of the thermostability of P. torridus proteins

What purification strategies are most effective for obtaining active P. torridus HtpX?

Purification of active P. torridus HtpX requires special considerations due to its membrane-bound nature and autocatalytic activity. Based on approaches used for HtpX homologs and other P. torridus proteins:

Initial Extraction:

  • Cell lysis via French pressure cell or sonication in buffer containing 100 mM Na-acetate, pH 6.0

  • Membrane solubilization requires detergents, with care taken to prevent premature activation

  • For HtpX homologs, purification under denaturing conditions followed by controlled refolding has been successful

Purification Steps:

  • Heat precipitation (60°C for 30 min) as an initial purification step to remove most mesophilic proteins

  • Affinity chromatography using His-tag (ideally a His₁₀ tag for stronger binding)

  • Ion exchange chromatography for further purification

  • Storage in 50% glycerol in a Tris-based buffer optimized for the protein

Critical Considerations:

  • Purification under denaturing conditions may be necessary to prevent autodegradation

  • Refolding should be performed in the presence of a zinc chelator to prevent premature activation

  • Final storage at -20°C, with avoidance of repeated freeze-thaw cycles (store working aliquots at 4°C for up to one week)

How can the proteolytic activity of P. torridus HtpX be measured in vitro?

Several methods have been developed to measure HtpX proteolytic activity:

Self-Cleavage Assay:

  • Monitor autocatalytic cleavage upon addition of Zn²⁺ using SDS-PAGE analysis

  • This provides a direct measure of the intrinsic activity of the enzyme

Substrate-Based Assays:

  • Casein degradation assay: HtpX homologs have been shown to degrade casein in the presence of zinc

  • Membrane protein degradation assay: Using solubilized membrane proteins like SecY as substrates

  • Zymography analysis: Using substrate-containing gels to visualize proteolytic activity

Quantitative Analysis:

  • Spectrophotometric assays measuring release of chromogenic or fluorogenic peptides

  • For enzymes from extremophiles, temperature and pH must be carefully controlled to ensure optimal conditions (pH 1-2 and temperatures up to 60°C for P. torridus proteins)

Critical Parameters:

  • Inclusion of Zn²⁺ at appropriate concentrations (typically 1-5 mM) is essential for activity

  • Temperature control is critical - activity should be assessed at temperatures relevant to P. torridus (45-65°C)

  • pH optimization - testing across a range of pH values (0-4) reflecting the native environment of P. torridus

What in vivo assay systems exist for studying HtpX protease activity?

In vivo assay systems have been developed for studying HtpX activity, which could be adapted for P. torridus HtpX:

Model Substrate Systems:

  • An in vivo semiquantitative and convenient protease activity assay system has been established using a constructed model substrate for E. coli HtpX

  • This system enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions

Components of the Assay System:

  • A model substrate (XMS1) that allows sensitive detection of protease activity

  • Analysis of full-length (XMS1-FL) and cleaved fragments (CL-C and CL-N) to monitor proteolytic activity

  • Western blotting with appropriate antibodies to detect substrate cleavage

Adaptation for P. torridus HtpX:

  • Expression in appropriate host systems (possibly thermophilic hosts)

  • Design of substrates containing recognition sequences for P. torridus HtpX

  • Use of expression systems allowing temperature and pH control

Example of Implementation:
In studies of recombinant DX-3-htpX protease from gut bacteria, researchers measured enzyme activity in fermentation broths, achieving activity levels of 135.68 ± 3.66 U/mL compared to wild-type levels of 2.19 ± 0.28 U/mL, demonstrating a 61.9-fold increase in activity through recombinant expression .

What are the key active site residues in P. torridus HtpX and how do they contribute to catalytic activity in extreme conditions?

The catalytic mechanism of P. torridus HtpX relies on several key features:

Active Site Composition:

  • The conserved HEXXH motif forms the metal binding site essential for catalytic activity

  • This motif coordinates a zinc ion that activates a water molecule for nucleophilic attack on the peptide bond

  • Additional residues contribute to substrate binding and transition state stabilization

Active Pocket Analysis:
When examining the binding of different ions to HtpX, research has identified specific changes in the active site. The following table shows comparative analysis of active pocket parameters with different bound ions:

ProteaseArea (Ų)Volume (ų)Active Sites in the Pocket
HtpX557.472837.241ARG4, LEU7, PHE8, VAL11, ALA52, SER55, LEU56, SER59, MET62, ALA63, TRP65, MET66, MET67, ASN113, ALA114, PHE115, ALA116, THR117, GLY118, MET132, VAL144, HIS147, GLU148, HIS151, MET157, THR160, THR161, LEU162, GLN164, ILE214, HIS217, SER218, ARG221, GLU222, MET238, ALA241, LEU242, LEU254, THR276, HIS277, ARG283
HtpX-Ca²⁺918.1541378.221LEU1, LYS3, ALA110, GLU111, VAL112, ASN113, ALA114, MET132, VAL144, HIS147, GLU148, ARG219, MET238, ALA241, LEU245, ARG246, THR248, THR249, SER250, VAL252, ASP253, GLN256, LYS257, ALA260, LYS263, ILE264, SER265, LYS267, GLU268, PHE270, SER271, ARG272, PHE274, SER275, HIS277, PRO278, PRO279, LEU280
HtpX-Zn²⁺811.0231179.127LEU1, LEU2, LYS3, ALA110, GLU111, VAL112, ASN113, ALA114, MET132, VAL144, HIS147, GLU148, ARG219, MET238, ALA241, LEU242, LEU245, ARG246, THR248, THR249, VAL252, ASP253, GLN256, LYS257, ALA260, LYS263, ILE264, SER265, LYS267, GLU268, SER271, ARG272, SER275, HIS277, PRO278, PRO279, LEU280, GLU281, ARG283

As demonstrated in the table, Ca²⁺ binding to HtpX produces the largest active pocket (918.154 Ų), which may contribute to enhanced catalytic efficiency .

Adaptations for Extreme Conditions:

  • Increased content of acidic amino acids on the protein surface to maintain solubility at low pH

  • Enhanced hydrophobic interactions in the protein core for thermostability

  • Strategic placement of salt bridges and disulfide bonds to maintain structure at high temperatures and low pH

How can molecular modeling approaches be used to predict substrate specificity of P. torridus HtpX?

Molecular modeling provides valuable insights into P. torridus HtpX substrate specificity:

Structure Prediction Approaches:

  • For P. torridus HtpX, which has limited sequence similarity to characterized homologs, the Phyre2 server has been used successfully to generate structural models based on templates from S. mikatae

  • More advanced protein structure prediction methods like AlphaFold3 have been employed to predict the 3D structure

Active Site Analysis:

  • PYMOL can be used to visualize the three-dimensional structure and active site architecture

  • CASTpFold analysis can predict the active site dimensions and binding pocket characteristics

  • Homology models can reveal the structural basis for the distinct substrate preferences of P. torridus HtpX

Substrate Docking Simulations:

  • Molecular docking studies can predict potential substrate binding modes

  • The unique active site topology of P. torridus HtpX likely determines its substrate specificity

  • Molecular dynamics simulations can help understand substrate recognition under extreme pH and temperature conditions

Key Findings from Modeling Studies:

  • The model of HtpX consists of ten α-helices, four strands, two 310 helices, twelve turns, seven bends, and multiple coil regions

  • Different ions (Ca²⁺, Zn²⁺, Cl⁻, K⁺) binding to HtpX can change the 3D structure and active sites

  • The binding of Ca²⁺ creates the largest active pocket, potentially enhancing substrate accommodation

What are the potential biotechnological applications of recombinant P. torridus HtpX?

P. torridus HtpX has several promising biotechnological applications due to its extreme stability and unique proteolytic properties:

Industrial Enzyme Applications:

  • As an extremozyme, P. torridus HtpX can catalyze reactions under harsh conditions where conventional proteases fail

  • Potential applications in detergents formulated for high-temperature washing or acidic cleaning solutions

  • Use in leather processing, which often involves acidic conditions

Biocatalysis:

  • Peptide synthesis in organic solvents or at elevated temperatures

  • Modification of proteins under conditions that denature conventional enzymes

  • Stereoselective hydrolysis of peptide bonds for pharmaceutical applications

Analytical Tools:

  • Protein sequencing and analysis under denaturing conditions

  • Digestion of complex, aggregation-prone proteins

  • Structural proteomics applications requiring stable proteases

Research has demonstrated:

  • The recombinant DX-3-htpX protease exhibits a 61.9-fold increase in fermentation activity compared to native levels

  • It maintains temperature tolerance with activity preserved at 50°C for 8 hours

  • Its optimal activity occurs at neutral pH, but it maintains stability across a wide pH range

How does P. torridus HtpX function as part of the protein quality control system in extremophiles?

The role of HtpX in protein quality control systems has been studied mainly in bacteria like E. coli, with implications for understanding its function in extremophiles like P. torridus:

Quality Control Functions:

  • HtpX is involved in the proteolytic quality control of membrane proteins

  • It functions as part of a stress response system to eliminate damaged or misfolded proteins

  • In E. coli, HtpX works in conjunction with FtsH, an ATP-dependent membrane-bound protease

Stress Response Mechanisms:

  • HtpX is a heat-inducible protein, suggesting its role in responding to thermal stress

  • In P. torridus, which lives at extremely low pH and high temperature, HtpX likely plays a crucial role in maintaining protein homeostasis under these harsh conditions

  • The distribution of HtpX across 132 archaeal genomes (out of 144 studied) indicates its evolutionary importance in archaea

Regulatory Networks:

  • In E. coli, htpX gene expression is controlled by the CpxR/CpxA extracytoplasmic stress response system

  • Similar regulatory systems may exist in extremophiles, adapted to sense specific environmental stresses

  • The genomic context of htpX in P. torridus may provide clues about its regulation

Research Context:

  • P. torridus contains numerous repair and recombination proteins, suggesting sophisticated mechanisms for maintaining cellular integrity under extreme conditions

  • The presence of HtpX in multiple copies in some archaeal genomes (two or three copies in 48 genomes out of 144 studied) suggests specialized roles or differential regulation

How can site-directed mutagenesis be used to investigate the structure-function relationship of P. torridus HtpX?

Site-directed mutagenesis offers powerful approaches for understanding structure-function relationships in P. torridus HtpX:

Key Targets for Mutagenesis:

  • The conserved HEXXH motif (metal binding site)

  • Residues in the active pocket identified from structural models

  • Conserved residues unique to extremophilic HtpX homologs

  • Transmembrane regions and their role in membrane association and substrate recognition

Experimental Approaches:

  • Generate point mutations using PCR-based methods or CRISPR-Cas9 technologies

  • Express mutant proteins using optimized expression systems

  • Purify and characterize mutants using activity assays, thermal stability measurements, and structural analyses

  • Assess the impact of mutations on:

    • Catalytic efficiency (kcat/Km)

    • Substrate specificity

    • pH optimum and range

    • Thermal stability and activational parameters

    • Metal binding affinity

Functional Analysis System:

  • The in vivo protease activity assay system established for E. coli HtpX can be adapted to detect differential activities of P. torridus HtpX mutants

  • This system allows for semiquantitative analysis of the effects of mutations in conserved regions

Expected Outcomes:

  • Identification of residues critical for extreme pH and temperature adaptation

  • Understanding the molecular basis of substrate recognition

  • Insights into the catalytic mechanism under extreme conditions

  • Rational design of HtpX variants with enhanced properties for biotechnological applications

What techniques can be used to study the membrane topology and substrate interaction mechanisms of P. torridus HtpX?

Understanding the membrane topology and substrate interactions of P. torridus HtpX requires specialized techniques:

Membrane Topology Analysis:

  • Cysteine-scanning mutagenesis followed by accessibility labeling

  • Fusion protein approaches with topology reporters

  • Limited proteolysis of membrane-bound HtpX

  • Computational topology prediction verified by experimental approaches

Substrate Interaction Studies:

  • Crosslinking experiments with photo-activatable amino acid analogs

  • Protease-inactive mutants (e.g., mutation of the catalytic glutamate) to trap enzyme-substrate complexes

  • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in substrate binding

  • Intramolecular crosslinking experiments to study conformational changes during substrate processing

Advanced Structural Techniques:

  • Cryo-electron microscopy of HtpX in nanodiscs or detergent micelles

  • Solid-state NMR spectroscopy to analyze membrane-embedded structures

  • X-ray crystallography of detergent-solubilized HtpX in complex with inhibitors or substrate analogs

Research Approaches from Related Studies:

  • Intramolecular cross-linking experiments with Cys mutations to immobilize specific domains and test their role in activity

  • Based on studies of E. coli RseP (another membrane protease), methods to study substrate discrimination mechanisms include size exclusion analysis, gating mechanisms investigation, and helix unwinding studies

  • The structure and function of HtpX can be inferred from the observation that RseP captures substrate peptides via backbone hydrogen bonds with specific loops (L3 and L5)

What are common challenges in working with recombinant P. torridus HtpX and how can they be addressed?

Working with recombinant P. torridus HtpX presents several challenges due to its extremophilic origin and proteolytic activity:

Challenge 1: Protein Stability and Self-Cleavage

  • Problem: HtpX has autocatalytic activity in the presence of Zn²⁺, leading to self-degradation during expression and purification

  • Solution:

    • Purify under denaturing conditions to prevent autocatalytic degradation

    • Refold in the presence of zinc chelators

    • Add zinc only when activity measurements are performed

    • Store at -20°C in 50% glycerol and avoid repeated freeze-thaw cycles

Challenge 2: Membrane Protein Expression

  • Problem: As a membrane protein, HtpX can be difficult to express in soluble form

  • Solution:

    • Use specialized E. coli strains designed for membrane protein expression

    • Optimize inducer concentration and induction temperature (lower temperatures often improve membrane protein folding)

    • Consider fusion partners that enhance membrane protein expression

    • Use detergents or amphipols for solubilization

Challenge 3: Activity Measurement Under Extreme Conditions

  • Problem: Assaying activity at low pH and high temperature presents technical challenges

  • Solution:

    • Use buffers with appropriate buffering capacity at extremely low pH

    • Employ thermostable substrates and detection systems

    • Consider performing assays in sealed pressure-resistant vessels for high-temperature work

    • Include appropriate controls to account for non-enzymatic substrate degradation under extreme conditions

Challenge 4: Limited Structural Information

  • Problem: Limited structural information specific to P. torridus HtpX

  • Solution:

    • Apply advanced structural prediction tools like AlphaFold3

    • Use homology modeling based on available crystal structures (S. mikatae, V. parahaemolyticus)

    • Employ multiple computational approaches and validate with experimental data

How can the recombinant expression of P. torridus HtpX be optimized for maximum yield and activity?

Optimizing recombinant expression of P. torridus HtpX requires systematic approach to maximize yield and activity:

Expression System Optimization:

  • Host Selection:

    • E. coli BL21 codon plus (DE3)-RIL for enhanced expression of archaeal proteins with rare codons

    • Consider Bacillus-based expression systems for improved secretion and folding

    • For difficult proteins, cell-free expression systems may provide advantages

  • Vector Design:

    • pET vectors with strong, inducible promoters

    • Include appropriate fusion tags (His10 tag may be preferable to His6 for stronger binding)

    • Consider including solubility-enhancing fusion partners

Expression Conditions:

  • Temperature:

    • Lower temperatures (20°C) after induction to promote proper folding

    • For thermostable proteins, higher expression temperatures may increase yield

  • Media and Supplements:

    • Rich media (like Terrific Broth) to increase biomass

    • Addition of zinc chelators to prevent premature self-cleavage

    • Consider osmotic stress protectants for membrane protein expression

  • Induction Strategy:

    • Optimize IPTG concentration (typically 0.4 mM)

    • Auto-induction media for convenient high-density culture

    • Determine optimal induction timing and duration

Purification Strategy Optimization:

  • Initial heat treatment (60°C, 30 min) to remove host proteins

  • Immobilized metal affinity chromatography with optimized binding and elution conditions

  • Consider on-column refolding for proteins purified under denaturing conditions

  • Final polishing steps (ion exchange, size exclusion) to ensure homogeneity

Activity Preservation:

  • Store in 50% glycerol in an optimized Tris-based buffer

  • Aliquot to avoid repeated freeze-thaw cycles

  • For working solutions, maintain at 4°C for up to one week

  • Consider addition of stabilizing agents specific to metalloenzymes

How does P. torridus HtpX compare to homologs from other extremophiles in terms of structure and function?

P. torridus HtpX has distinct features when compared to homologs from other extremophiles:

Extremophile HtpX Distribution:

  • HtpX is present in 132 out of 144 archaeal genomes studied

  • Multiple copies (two or three) are present in 48 genomes, suggesting functional specialization

  • All genomes from the Sulfolobus family have three copies of the HtpX gene

  • Two copies are present in some genomes of Halobacteriales, Methanosarcinales, and Thermoproteales

Structural Comparisons:

  • P. torridus HtpX has very little sequence similarity with characterized homologs

  • Despite sequence divergence, the core catalytic motif (HEXXH) is conserved across extremophiles

  • Different extremophiles show adaptations in surface charge distribution and hydrophobic core packing

Functional Adaptations:

  • Halophilic homologs typically have increased acidic residue content on the surface

  • Thermophilic variants show increased proline content and enhanced hydrophobic interactions

  • Psychrophilic homologs demonstrate greater flexibility in loop regions

  • Acidophilic variants like P. torridus HtpX have specific adaptations for function at extremely low pH

Evolutionary Context:

  • The gene sequences reflect adaptations to specific extreme environments

  • Conservation of the metalloprotease domain indicates the fundamental importance of this proteolytic mechanism

  • Variations in flanking domains and regulatory regions suggest diverse functional roles and regulation mechanisms

What can genomic context analysis reveal about the functional role of HtpX in P. torridus?

Genomic context analysis provides valuable insights into the functional role of HtpX in P. torridus:

Gene Organization:

  • The htpX gene in P. torridus is designated as PTO0160 in the genome annotation

  • Analysis of neighboring genes can reveal functional associations and potential operonic structures

  • P. torridus has a compact 1.55 megabase genome with 1,535 open reading frames (ORFs)

Regulatory Elements:

  • Identification of promoter regions and potential regulatory binding sites upstream of htpX

  • Comparative analysis of regulatory regions across archaeal species

  • Potential stress-responsive elements in the promoter region

Functional Associations:

  • Co-expression patterns with other genes involved in protein quality control

  • Presence of other proteases and chaperones in the genomic vicinity

  • Relationship to stress response systems in the P. torridus genome

Evolutionary Insights:

  • P. torridus genome contains numerous repair and recombination proteins, suggesting sophisticated mechanisms for maintaining cellular integrity under extreme conditions

  • The presence of htpX in this context indicates its importance in the cellular stress response network

  • Comparative genomics across archaeal species reveals conservation patterns and potential horizontal gene transfer events

Research Applications:

  • Targeted gene disruption or modification to assess phenotypic effects

  • Transcriptomic analysis under various stress conditions to understand regulation

  • Construction of synthetic operons for co-expression of functionally related genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.