Recombinant Pig 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

Shipped with Ice Packs
In Stock

Description

Introduction

3β-Hydroxysteroid dehydrogenase/Δ5-Δ4 isomerase (3β-HSD), also known as HSD3B, is a crucial enzyme involved in steroidogenesis . Specifically, it catalyzes the conversion of Δ5-3β-hydroxysteroids to Δ4-3-ketosteroids, a vital step in the biosynthesis of all classes of hormonal steroids, including progestogens, androgens, and glucocorticoids . Recombinant Pig HSD3B refers to the enzyme produced using recombinant DNA technology in pig cells. This article aims to provide a detailed overview of Recombinant Pig HSD3B, covering its function, regulation, and significance in steroid hormone production.

Function and Mechanism of Action

HSD3B plays a pivotal role in steroid hormone synthesis by catalyzing two sequential reactions :

  1. The oxidation of the 3β-hydroxyl group to a 3-keto group.

  2. The isomerization of the Δ5 double bond to the Δ4 position.

These steps are essential for the production of progesterone, androgens, and glucocorticoids. The enzyme is responsible for the conversion of pregnenolone to progesterone, 17α-hydroxypregnenolone to 17α-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to androstenedione, and androstenediol to testosterone .

Expression and Localization

The expression of HSD3B has been observed in various tissues, including the adrenal glands, gonads (testes and ovaries), and placenta, which are key sites for steroid hormone production . In the testes, HSD3B is predominantly expressed in Leydig cells, the primary source of androgen production . Studies have also shown its presence in Sertoli cells of some primate species .

Regulation of HSD3B

The regulation of HSD3B expression and activity is complex and involves multiple factors, including gonadotropins and steroids . Studies using Leydig cells from immature pigs have demonstrated that human chorionic gonadotropin (hCG) increases HSD3B mRNA expression in a dose- and time-dependent manner . This indicates that gonadotropins can regulate HSD3B .

Significance in Porcine Reproduction

In porcine ovarian cells, HSD3B is critical for progesterone synthesis . Progesterone, a key hormone for maintaining pregnancy, is synthesized from pregnenolone via the action of HSD3B . A study showed that vaspin, a hormone, can stimulate the protein expression of HSD3B in porcine ovaries, thereby affecting steroid hormone levels . Furthermore, the functionality of HSD3B in the ovaries can be influenced by Follicle-Stimulating Hormone (FSH) glycosylation variants, where different variants impact the steroidogenic enzyme expression differently .

HSD3B and FSH Glycoforms

Research indicates that different human Follicle Stimulating Hormone (hFSH) glycoforms can differentially regulate HSD3B expression . For instance, hFSH21 was found to upregulate HSD3B transcripts significantly, which correlated with increased HSD3B protein levels and progesterone secretion by granulosa cells .

Table: Effects of hFSH Glycoforms on Steroidogenic Gene Expression in Porcine Granulosa Cells

The following data is derived from in vitro studies of porcine granulosa cells treated with different hFSH glycoforms :

GeneEffect of hFSH21Effect of hFSH24
HSD3BUpregulationNo significant change
STARUpregulationNo significant change
CYP11A1No changeNo change
CYP19ADownregulationDownregulation

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its use.
Synonyms
HSD3B; 3b-HSD; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 3-beta-HSD [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
HSD3B
Target Protein Sequence
AGWSCLVTGGGGFLGQRIVHLLLEEKDLQEIRVLDKVFKPEVREEFSKLQSKIKLTMLEG DILDEQCLKGACQGASVVIHTASIIDVVNAVGRETVMKVNVKGTQLLLEACVQASVPVFI HTSSIEVAGPNSYREVIQNACEEDRLETAWSAPYPLSKKLAEKAVLEANGWALQNGGTLH TCALRPMYIYGEGSPFIFAHMNKALENNGVLTHNSKFSRVNPVYVGNVAWAHILALRALR DPRKALSVQGQFYYVADDTPPQSYDDLNYTLGKEWGFCLDSRRSLPPSLRYWLAFLLEIV SFLLSPIYNYQPPFNRHFVTLCNSVFTVSYKKAQRDLGYEPLFTWEEAKQKTKAWVGSLV KQHKEALKTKTH
Uniprot No.

Target Background

Function

3β-Hydroxysteroid dehydrogenase/Δ54 isomerase (3β-HSD) is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of steroid hormones.

Gene References Into Functions
  1. Apelin/APLNR presence in porcine corpora lutea and apelin's stimulatory effects on progesterone secretion and 3β-HSD levels suggest potential autocrine/paracrine regulation during the luteal phase of the estrous cycle. PMID: 29576467
  2. Glucocorticoid receptor binding to the 3β-HSD promoter influences differential hepatic 3β-HSD expression between boars and barrows. PMID: 28877400
  3. Adiponectin and insulin regulate the expression of StAR, CYP11A1, and HSD3B1 genes and the secretion of progesterone and androstenedione by porcine endometrial and myometrial tissue explants during early pregnancy and the estrous cycle. PMID: 27512005
  4. Androgen blockade effects on the expression of 3β-hydroxysteroid dehydrogenase (3β-HSD), CYP17, and 17β-hydroxysteroid dehydrogenase type 1 (17β-HSD1) in the porcine fetus are described. PMID: 25130044
  5. Uncastrated Duroc pigs with the GG SNP5 genotype exhibited significantly higher 3β-HSD mRNA levels compared to those with other SNP5 genotypes. PMID: 23581486
  6. New insights into the transcriptional regulation of 3βHSD1 and 17βHSD7 and their involvement in steroid metabolism are presented. PMID: 22405929
  7. Significant sequence variations, including differences in TTAT repeat numbers and three SNPs, were observed in the 5' flanking region of the 3β-HSD gene across different breeds. PMID: 17060418
  8. 3βHSD mRNA expression was detected by RT-PCR in samples from various stages of pregnancy. PMID: 17647136
  9. Genistein and daidzein directly affect porcine granulosa cell progesterone synthesis by inhibiting 3β-HSD enzyme activity. PMID: 17728101
Database Links

KEGG: ssc:445539

UniGene: Ssc.14393

Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of 3β-hydroxysteroid dehydrogenase/Δ5-Δ4 isomerase in pigs?

3β-HSD catalyzes a critical two-step reaction in steroid hormone metabolism: the oxidation and isomerization of Δ5-3β-hydroxysteroid precursors into Δ4-ketosteroids . This membrane-bound enzyme performs both 3β-hydroxysteroid dehydrogenation and the subsequent isomerization of the double bond from the Δ5 to the Δ4 position . In pigs, this enzyme is essential for:

  • Steroid hormone synthesis, including progesterone and testosterone production

  • Hepatic degradation of pheromones, particularly androstenone

  • Metabolism of both endogenous steroids and xenobiotics

The catalytic efficiency of this enzyme is remarkably high, performing reactions approximately 10¹¹ times faster than would occur in aqueous solution without enzymatic catalysis .

How does porcine 3β-HSD expression differ across tissues and developmental stages?

Porcine 3β-HSD shows distinct tissue-specific expression patterns:

TissueExpression CharacteristicsFunctional Role
LiverHighly expressed for steroid degradationRegulation of steroid hormone levels; androstenone metabolism
TestesPrimarily in Leydig cellsSteroidogenesis; sex hormone production
OvariesLocalized to theca interna layerFollicular steroidogenesis
Adipose tissueOne characterized isoformLocal metabolism of androstenone
Adrenal glandLower expression than testes in fetal developmentSteroid hormone production

Development-specific differences are also observed. For instance, fetal testes express higher levels of 3β-HSD than fetal adrenal glands at all developmental stages . Expression patterns change during follicular development in ovaries, with increasing expression observed throughout follicular maturation .

How many isoforms of 3β-HSD have been identified in pigs compared to other mammals?

The number of 3β-HSD isoforms varies considerably across mammalian species:

SpeciesNumber of Identified IsoformsNotable Characteristics
PigsCurrently one characterizedExpressed in liver, gonads, and adipose tissue
HumansTwo (HSD3B1 and HSD3B2)Type I in placenta/peripheral tissues; Type II in adrenal/gonads
MiceSix isoformsMultiple tissue-specific variants
RatsTwo isoformsSimilar to human distribution pattern

Phylogenetic analyses suggest that the diversification of 3β-HSD genes occurred relatively late in mammalian evolution, with subsequent lineage-specific development . This explains the species-specific differences in isoform numbers and expression patterns.

What expression systems have been successfully employed for recombinant pig 3β-HSD production?

Multiple expression systems have been utilized for recombinant porcine 3β-HSD production, each with distinct advantages:

Expression SystemMethodology DetailsKey Findings
E. coliIPTG-inducible tac promoter systemSuccessful expression of soluble, active enzyme (MW: 30.5 kDa); protein detected in soluble lysate fraction
HEK293 cellsTransfection with HSD3B expression vectorsEffective for functional studies of wild-type and mutant enzymes; maintains mammalian post-translational modifications
HEK293T cellsSimilar to HEK293 but with higher transfection efficiencySuccessfully used for rabbit HSD17B14 expression with L-fucose dehydrogenase activity

The E. coli system has been particularly well-characterized for pig testicular 3α/β(20β)-hydroxysteroid dehydrogenase, producing a soluble enzyme with a molecular weight of approximately 30.5 kDa that retains catalytic activity against multiple substrates .

What purification strategies yield functional recombinant pig 3β-HSD?

Effective purification of recombinant porcine 3β-HSD requires:

  • Column chromatography using DEAE-cellulose has successfully yielded apparently homogeneous enzyme as determined by SDS-PAGE analysis

  • The purified recombinant enzyme should be verified for:

    • Molecular weight (approximately 30.5 kDa for pig testicular 3α/β(20β)-HSD)

    • Amino-terminal sequence (for pig testicular recombinant 3α/β(20β)-HSD, serine is the N-terminal residue, unlike the native enzyme which has a blocked N-terminus)

    • Catalytic activity with appropriate substrates (e.g., 5α-dihydrotestosterone, progesterone, and 17α-hydroxyprogesterone)

The purified recombinant enzyme should retain the full spectrum of activity observed in the native enzyme, including the ability to reduce steroids, prostaglandins, and other carbonyl compounds such as aldehydes, ketones, and quinones .

How can researchers verify the proper folding and enzymatic activity of recombinant 3β-HSD?

Multi-method verification is essential to confirm proper folding and activity:

  • Protein-level verification:

    • Western blotting with specific antibodies

    • SDS-PAGE for molecular weight confirmation (30.5 kDa for pig testicular 3α/β(20β)-HSD)

    • N-terminal sequencing to confirm protein identity

  • Enzymatic activity assays:

    • Traditional methods: Monitor substrate conversion using radioisotopes or liquid chromatography-mass spectrometry

    • Cell-based reporter systems: Utilize PR- or AR-mediated transactivation to measure the conversion of pregnenolone (P5) to progesterone (P4) or dehydroepiandrosterone (DHEA) to androstenedione (A4)

    • Substrate specificity testing: Confirm activity with expected substrates (5α-dihydrotestosterone, progesterone, 17α-hydroxyprogesterone) in the presence of appropriate cofactors (NADPH)

The recently developed cell-based reporter system offers a particularly valuable methodological advance, as it allows for easier evaluation of enzymatic activities toward multiple substrates without requiring complex analytical techniques .

What methods can be used to evaluate the enzymatic activity of pig 3β-HSD toward different substrates?

Several methodological approaches can be employed:

  • Traditional analytical methods:

    • Radioactive isotope labeling

    • Liquid chromatography-mass spectrometry (LC-MS/MS)

    • These methods are sensitive but complex and time-consuming

  • Reporter-based cell systems:

    • A novel method utilizing progesterone receptor (PR) and androgen receptor (AR)-mediated transactivation has been developed to measure 3β-HSD activity

    • Workflow: HEK293 cells expressing HSD3B2 are incubated with substrates (P5 or DHEA) → Culture media containing converted products are transferred to CV-1 cells transfected with PR/AR and a hormone-responsive reporter → Luciferase activity is measured to quantify conversion

    • This system allows for evaluation of enzymatic activity toward multiple physiologically relevant substrates in a single experimental platform

  • Enzyme kinetics:

    • Determine Km, Vmax, and catalytic efficiency (kcat/Km) for various substrates

    • Compare substrate preference and catalytic parameters across wild-type and mutant enzymes

For example, when human HSD17B14 (related to the hydroxysteroid dehydrogenase family) was evaluated, it exhibited a catalytic efficiency for L-fucose that was 359-fold higher than its efficiency for estradiol, demonstrating the importance of comprehensive substrate profiling .

How do signaling pathways and transcription factors regulate pig 3β-HSD expression?

3β-HSD expression in pigs is regulated by multiple signaling pathways and transcription factors:

Regulatory Pathway/FactorTissue/ContextEffect on 3β-HSD
LH/hCG ReceptorLeydig cellsIncreases mRNA expression in a dose- and time-dependent manner
JAK-STAT pathwayMultiple tissuesSTAT5 and STAT6 activation influences transcription
Nuclear ReceptorsLiver, gonadsSF-1, LRH-1, ERα, AR, and PPARα modulate expression
GATA4 and GATA6Gonadal tissuesPotential activators; co-transfection with SF-1 and LRH-1 enhances promoter activation
Steroid FeedbackLiver, testesAndrogens can inhibit 3β-HSD expression in testes; estrone sulfate and androstenone induce expression in hepatocytes from heavy-weight pigs

Developmental timing affects regulatory responses. For example, hepatocytes from low-weight pigs (70 kg) show different responses to steroid treatment compared to those from heavy-weight pigs (92 kg) . This suggests age-dependent regulatory mechanisms that may relate to sexual maturation.

How does castration (surgical vs. immunological) affect 3β-HSD expression in pigs?

Both surgical castration (SC) and immunological castration significantly impact 3β-HSD expression:

Castration MethodTimingEffect on 3β-HSD ExpressionSteroid LevelsAssociated Changes
Surgical castrationBefore 7 days of ageIncreased mRNA and protein expressionLower levels of all steroids in plasmaIncreased 3β-HSD and SULT2A1 expression
Immunological castration (Improvac®)Two injections at 11 and 14 weeksSimilar effects to surgical castrationReduced testosterone and androstenoneIncreased hepatic 3β-HSD expression
Immunological castration (Improvac®)Two injections at 17 and 21 weeksSimilar effects to surgical castrationReduced testosterone and androstenoneIncreased hepatic 3β-HSD expression

Research demonstrates a strong correlation between 3β-HSD mRNA/protein expression and steroid levels, suggesting that steroid concentrations can influence the expression of this enzyme . This bidirectional relationship indicates that decreasing steroid hormone levels through castration subsequently increases 3β-HSD expression, potentially as a compensatory mechanism.

How can researchers evaluate the functional impact of HSD3B mutations using recombinant systems?

A methodical approach to evaluating mutant 3β-HSD function includes:

  • Expression vector construction:

    • Site-directed mutagenesis to introduce specific mutations into wild-type HSD3B cDNA

    • Cloning into appropriate expression vectors (e.g., for mammalian cell transfection)

  • Cell-based functional assessment:

    • Transfection of HEK293 cells with wild-type or mutant constructs

    • Culture with substrates (P5 or DHEA)

    • Transfer of media to reporter cells (CV-1) transfected with PR/AR and hormone-responsive elements

    • Quantification of luciferase activity to measure enzymatic function

  • Correlation with clinical phenotypes:

    • For HSD3B2 mutations associated with congenital adrenal hyperplasia:

      • Mutations in patients with salt-wasting (SW) typically show severely reduced enzyme activity

      • Mutations without SW may retain partial enzymatic function

      • Different mutations can affect conversion of P5 to P4 (mineralocorticoid pathway) or DHEA to A4 (androgen pathway) to varying degrees

This system has been successfully applied to evaluate four HSD3B2 missense mutations, demonstrating correlations between reduced enzymatic activities and the severity of clinical symptoms in patients .

What structural and functional insights have been gained from site-directed mutagenesis of pig 3β-HSD?

Site-directed mutagenesis studies of pig 3α/β(20β)-HSD have provided key insights:

Such studies are essential for understanding evolutionary adaptations in enzyme function across species and for identifying potential targets for enzyme engineering or therapeutic intervention.

How is pig 3β-HSD involved in androstenone metabolism and what are the implications for boar taint research?

Porcine 3β-HSD plays a crucial role in androstenone metabolism with significant implications for boar taint:

  • Biochemical pathway:

    • 3β-HSD catalyzes the first phase of hepatic androstenone degradation

    • The enzyme converts androstenone to less odorous metabolites

    • Insufficient 3β-HSD activity results in androstenone accumulation in adipose tissue, contributing to boar taint

  • Regulatory factors affecting androstenone metabolism:

    • Age/weight: Heavier pigs show different hepatic 3β-HSD responses to steroids compared to lighter animals

    • Castration: Both surgical and immunological castration increase 3β-HSD expression while decreasing androstenone production

    • Diet: Dietary components, including isoflavones like genistein and daidzein, can modulate 3β-HSD enzyme kinetics

  • Research applications:

    • Screening dietary compounds that enhance 3β-HSD expression/activity

    • Genetic selection for pigs with higher hepatic 3β-HSD activity

    • Development of 3β-HSD inducers as alternatives to castration

Understanding the regulation and activity of porcine 3β-HSD provides pathways to address boar taint while potentially avoiding surgical castration, addressing both quality and animal welfare concerns in pork production .

How does pig 3β-HSD interact with xenobiotics and what are the implications for toxicology?

Porcine 3β-HSD exhibits notable xenobiotic-metabolizing capabilities:

  • Direct metabolism of xenobiotics:

    • 3β-HSD can metabolize estrogenic mycotoxins such as zearalenone

    • The enzyme converts zearalenone into metabolites in pig liver

    • Recombinant pig 3α/β(20β)-HSD has demonstrated activity against prostaglandins and various carbonyl compounds including aldehydes, ketones, and quinones

  • Environmental toxicology implications:

    • Compounds affecting 3β-HSD activity can disrupt steroid metabolism

    • Environmental toxins may impair 3β-HSD function, potentially affecting reproduction and development

    • Understanding 3β-HSD xenobiotic metabolism helps assess toxicological risks of feed contaminants

  • Methodological approaches for investigating xenobiotic interactions:

    • In vitro incubation of recombinant 3β-HSD with suspected xenobiotic substrates

    • LC-MS/MS analysis of metabolite formation

    • Cell-based reporter systems to measure alterations in enzyme activity when exposed to xenobiotics

This research area offers important insights into how environmental compounds might affect steroid hormone balance in livestock and potentially humans through similar mechanisms.

What new methodological approaches are emerging for studying recombinant pig 3β-HSD in disease models?

Emerging methodological advances for studying recombinant pig 3β-HSD include:

  • Cell-based reporter systems:

    • The recently developed PR/AR-mediated transactivation system enables efficient evaluation of enzymatic activities toward multiple substrates

    • This approach simplifies complex analytical procedures and facilitates high-throughput screening

  • Applications to disease modeling:

    • Evaluation of structure-function relationships in HSD3B2 mutations associated with congenital adrenal hyperplasia

    • Assessment of partial enzymatic activities that may explain heterogeneous clinical presentations

    • The system has successfully demonstrated correlations between in vitro enzyme activities and clinical salt-wasting phenotypes

  • Potential future directions:

    • Development of humanized pig models with specific HSD3B mutations for studying human steroidogenic disorders

    • Application to drug discovery for conditions involving altered steroid metabolism

    • Investigation of tissue-specific regulation to better understand localized steroid effects

These methodological advances provide powerful tools for understanding both normal physiology and pathological conditions related to steroid metabolism across species, with particular relevance to translational medicine.

How does pig 3β-HSD function compare with other hydroxysteroid dehydrogenase family members?

Recent research has revealed unexpected functional diversity within the hydroxysteroid dehydrogenase family:

  • Substrate promiscuity:

    • HSD17B14, traditionally considered a steroid-metabolizing enzyme, was recently identified as the mammalian L-fucose dehydrogenase

    • This enzyme catalyzes the oxidation of L-fucose to L-fucono-1,5-lactone with a catalytic efficiency 359-fold higher than its efficiency for estradiol

    • Similarly, pig 3α/β(20β)-HSD demonstrates activity toward diverse substrates beyond steroids

  • Evolutionary specialization:

    • Species-specific substrate preferences exist even within highly conserved enzymes

    • For example, rat HSD17B14 exhibits negligible activity toward L-fucose, while rabbit and human enzymes efficiently metabolize this substrate

    • This suggests evolutionary adaptation of enzyme function to species-specific metabolic requirements

  • Dual catalytic activities:

    • Many HSDs, including pig 3β-HSD, possess multiple catalytic capabilities

    • The 3β-HSD/Δ5-Δ4 isomerase activities occur at the same active site, demonstrating remarkable catalytic versatility

This functional plasticity within the hydroxysteroid dehydrogenase family highlights the importance of comprehensive substrate profiling and cross-species comparisons when characterizing these enzymes.

What techniques have been most effective for elucidating structure-function relationships in recombinant pig 3β-HSD?

Multiple complementary approaches have advanced our understanding of structure-function relationships:

  • Site-directed mutagenesis:

    • Mutation of specific residues (e.g., Tyr-194 and Lys-198) in the catalytic site to determine their roles in enzyme function

    • Comparison of mutant phenotypes to identify residues critical for substrate binding, catalysis, or structural integrity

  • Comparative analysis across species:

    • Alignment of sequences from various species to identify conserved domains

    • Correlation of sequence differences with functional variations to identify species-specific adaptations

  • Enzyme kinetics with multiple substrates:

    • Determination of catalytic parameters (Km, kcat, kcat/Km) for various substrates

    • Comparison of substrate preferences between wild-type and mutant enzymes to map substrate binding regions

  • Expression of targeted mutations associated with clinical phenotypes:

    • Expression of mutations identified in patients with steroidogenic disorders

    • Correlation of in vitro activities with clinical presentations to understand structure-function relationships in a physiological context

These approaches collectively provide a comprehensive understanding of the structural determinants of pig 3β-HSD function and its evolutionary relationships with homologous enzymes in other species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.