Recombinant Pig 5-hydroxytryptamine receptor 1D (HTR1D)

What is the molecular structure and characteristics of pig HTR1D protein?

Pig 5-hydroxytryptamine receptor 1D (HTR1D) is a G-protein coupled receptor consisting of 291 amino acids . The full-length sequence has been cloned and characterized from porcine cerebral cortex, revealing an open reading frame of 1134 nucleotides . Sequence analysis demonstrates that porcine HTR1D exhibits approximately 92% homology with the human 5-HT1D receptor and 88-90% homology with other species homologues . The amino acid sequence includes characteristic transmembrane domains typical of GPCRs, with the full sequence being:

AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIYSTCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSLHEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVASLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV

This protein is typically expressed with tags such as His-tag when produced as a recombinant protein for research applications .

How does recombinant pig HTR1D compare functionally to other species homologues?

For instance, when examining 5-HT receptor activation in similar systems, researchers found that the G-protein coupling efficacy of 5-HT1B receptors differs between guinea-pig and rat substantia nigra, with more efficacious responses measured in rat compared to guinea-pig (51±10% and 35±13%, respectively) . These species differences highlight the importance of considering evolutionary variances when using pig HTR1D as a model for human receptor function.

The pharmacological profile of porcine HTR1D has been evaluated after transient transfection in Cos-7 cells and compared with that of the recombinant human 5-HT1D receptor, providing insights into species-specific ligand binding and signaling properties .

What are the established methods for cloning and expressing recombinant pig HTR1D?

The established methodology for cloning and expressing recombinant pig HTR1D involves several key steps:

• RNA Extraction and Reverse Transcription: Total RNA is extracted from pig cerebral cortex tissue, followed by reverse transcription to generate cDNA .

• PCR Amplification: Using species-specific primers (initially designed based on guinea-pig 5-HT1D receptor coding sequence), the full-length receptor cDNA is amplified via RT-PCR .

• Verification of Complete Sequence: The 5′ and 3′ ends of the porcine 5-HT1D receptor cDNA can be verified using inverse PCR. This involves:

  • Digesting genomic DNA with restriction enzymes (e.g., EcoRI) that don't cut within the known sequence

  • Ligating the digested DNA to form circles

  • Amplifying with internal oligonucleotide inverse primers designed from the known receptor sequence

  • Primers used: 5′-GCATTGGAAAGGACAGTGGC-3′ (for 5′ end) and 5′-TCATCTGCTGGTTGCCCTTC-3′ (for 3′ end)

• Expression Systems: For recombinant protein production, E. coli expression systems have been successfully used, producing the protein with an N-terminal His-tag for purification purposes .

• Post-Production Processing: After expression, the protein is typically purified and prepared as a lyophilized powder, with recommended storage at -20°C/-80°C and reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

These methodologies provide a systematic approach for obtaining functional recombinant pig HTR1D for various research applications.

What functional assays are available for evaluating recombinant pig HTR1D activity?

Several complementary functional assays can be employed to evaluate the pharmacological and signaling properties of recombinant pig HTR1D:

• [35S]-GTPγS Binding Assay: This assay measures G-protein activation and is particularly useful for evaluating the efficacy and potency of receptor agonists and antagonists. In studies with related receptors, agonists like 5-HT and zolmitriptan increased, while antagonists like ketanserin decreased basal [35S]-GTPγS binding . For instance, zolmitriptan demonstrated a potency (pEC50: 8.46±0.08) that correlated well with its binding affinity in radioligand displacement assays .

• Radioligand Binding Assays: Using specific radioligands such as [3H]-5-CT and [3H]-GR125743 allows for determination of binding affinities (pKi values) for various ligands. Zolmitriptan, for example, showed binding affinities of pKi: 8.38±0.15 and 8.67±0.08 with these radioligands, respectively .

• Cell-Based Functional Assays: After transfection into appropriate cell lines (e.g., Cos-7 cells), the receptor's functional responses can be evaluated through:

  • Cell proliferation assays (e.g., CCK-8)

  • Colony formation assays

  • Migration and invasion assays (e.g., Transwell)

  • Apoptosis analysis (flow cytometry)

• Signaling Pathway Analysis: Western blot analysis to detect activation of downstream signaling components, particularly the PI3K/Akt pathway which has been linked to HTR1D function .

These complementary approaches provide a comprehensive evaluation of recombinant pig HTR1D receptor pharmacology and signaling properties.

How does HTR1D interact with intracellular signaling pathways in different experimental systems?

HTR1D engages multiple intracellular signaling cascades with the PI3K/Akt pathway emerging as particularly significant. Key interactions include:

• G-protein Activation: HTR1D primarily couples to inhibitory G-proteins (Gαi), as demonstrated in [35S]-GTPγS binding studies. When expressed with rat GαilCys351Ile protein, agonist stimulation of the receptor leads to measurable increases in [35S]-GTPγS binding, indicating G-protein activation .

• PI3K/Akt Pathway Regulation: HTR1D has been shown to activate the PI3K/Akt signaling pathway, a crucial mechanism involved in cell survival, proliferation, and drug resistance. Western blot analysis confirms that interference with HTR1D expression results in altered phosphorylation of PI3K and Akt proteins .

• Cell-Specific Signaling Effects: The signaling consequences of HTR1D activation appear to be cell-type dependent. In hepatocellular carcinoma cells (HCC), HTR1D activation promotes proliferation by decreasing apoptosis, as confirmed by flow cytometry analysis showing increased apoptotic ratios upon HTR1D interference .

The system-specific nature of these interactions highlights the importance of considering cellular context when studying HTR1D signaling. The receptor's engagement with the PI3K/Akt pathway appears particularly relevant in cancer cells, where it may contribute to malignant phenotypes and therapeutic resistance .

What structural differences between pig HTR1D and other species variants impact ligand binding and function?

Structural analysis of pig HTR1D compared to other species homologues reveals key differences that influence ligand binding and functional responses:

Understanding these structural differences is crucial for researchers when:

• Designing pharmacological experiments using pig HTR1D as a model

• Interpreting drug binding and signaling data

• Translating findings from animal models to human clinical applications

The identification of these species-specific variations provides valuable insights for exploring structure-activity relationships and receptor-ligand interactions.

What is the evidence for HTR1D involvement in cancer progression mechanisms?

Recent research has established significant links between HTR1D expression and cancer progression, particularly in hepatocellular carcinoma (HCC). Multiple lines of evidence support this association:

• Differential Expression Analysis: TCGA database analysis revealed that methylation of the HTR1D gene is associated with cancer status. Clinical sample studies confirmed significantly higher HTR1D expression in HCC tissues compared to adjacent tissues, with higher expression correlating with poorer patient prognosis .

• Quantitative Assessment: qPCR analysis demonstrated significantly higher mRNA expression levels of HTR1D in HCC tissues compared to paracancerous tissues. Additionally, HTR1D was significantly overexpressed in multiple HCC cell lines (SMMC7721, Hep3B, HCCLM3, MHCC97, Huh-7) compared to normal liver cells (L02) .

• Functional Studies: Interference with HTR1D gene expression through siRNA transfection resulted in:

  • Decreased proliferative ability of HuH-7 and Hep3B cells (confirmed by CCK-8 and colony formation assays)

  • Increased apoptotic ratio (demonstrated by flow cytometry)

  • Reduced migration and invasion rates (shown by Transwell assays)

• Therapeutic Resistance: HTR1D has been implicated in drug resistance mechanisms. After knocking down HTR1D expression, both Huh-7 and Hep3B cells showed increased sensitivity to sorafenib, the standard treatment for advanced HCC .

These findings collectively establish HTR1D as a potential therapeutic target and prognostic indicator in HCC, with its role in promoting proliferation, migration, invasion, and drug resistance mediated through the PI3K/Akt signaling pathway .

How does HTR1D expression and function differ across physiological and pathological states?

HTR1D expression and function exhibit significant variations across different physiological and pathological conditions, providing insights into its regulatory mechanisms and potential therapeutic targets:

These differences in expression and function highlight HTR1D as a promising target for therapeutic intervention, particularly in cancer contexts where its upregulation contributes to disease progression and treatment resistance.

What are the optimal storage and handling conditions for maintaining recombinant pig HTR1D stability?

Proper storage and handling of recombinant pig HTR1D is critical for maintaining protein stability and functional integrity. Based on established protocols, the following guidelines are recommended:

• Storage Temperature:

  • Long-term storage should be at -20°C/-80°C upon receipt

  • Working aliquots can be stored at 4°C for up to one week

• Aliquoting Strategy:

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Brief centrifugation prior to opening vials is recommended to bring contents to the bottom

• Reconstitution Protocol:

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration) is recommended for long-term storage

  • The default final concentration of glycerol is typically 50%

• Buffer Composition:

  • Optimal storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

• Stability Considerations:

  • Repeated freezing and thawing is not recommended as it may lead to protein denaturation and activity loss

  • Protein purity should be greater than 90% as determined by SDS-PAGE for optimal results

Adherence to these guidelines ensures maintenance of protein integrity and functional activity, which is essential for reliable experimental outcomes in both binding assays and functional studies.

What controls and validation steps are essential when designing experiments with recombinant pig HTR1D?

When designing experiments with recombinant pig HTR1D, several critical controls and validation steps should be incorporated to ensure data reliability and interpretation:

• Expression Verification:

  • Confirm protein expression using SDS-PAGE analysis

  • Verify protein purity (>90% recommended) before experimental use

  • Western blot analysis with specific anti-HTR1D antibodies to confirm identity

• Functional Validation:

  • Perform [35S]-GTPγS binding assays with known agonists (e.g., 5-HT, zolmitriptan) and antagonists (e.g., ketanserin) to confirm receptor functionality

  • Compare responses to established reference standards for the receptor

• Radioligand Binding Controls:

  • Include displacement curves with reference compounds of known affinity

  • Determine non-specific binding using saturating concentrations of unlabeled ligand

  • Calculate pKi values for standard ligands like [3H]-5-CT and [3H]-GR125743 to validate the binding assay

• Signaling Pathway Verification:

  • Include positive controls for PI3K/Akt pathway activation

  • Use pathway-specific inhibitors to confirm signaling specificity

  • Compare signaling responses between pig HTR1D and human HTR1D to account for species differences

• Experimental Design Considerations:

  • Include both positive controls (known activators) and negative controls (vehicle only)

  • Perform dose-response experiments to determine potency values (EC50/IC50)

  • Include time-course studies to capture optimal signaling responses

  • For interference studies (siRNA), include multiple distinct siRNA sequences to control for off-target effects

• Species Comparison Controls:

  • When translating results between species, include parallel experiments with human HTR1D

  • Consider the 8-10% sequence divergence between pig and human receptors when interpreting results

These validation steps ensure experimental rigor and facilitate accurate interpretation of results when working with recombinant pig HTR1D, particularly when translating findings to human applications.

How can researchers troubleshoot common issues in recombinant HTR1D expression and functional assays?

Researchers commonly encounter several challenges when working with recombinant HTR1D. Here are systematic approaches to troubleshoot these issues:

• Low Protein Expression Yields:

  • Problem: Insufficient protein recovery after expression in E. coli

  • Troubleshooting:

    • Optimize codon usage for the expression system

    • Adjust induction conditions (IPTG concentration, temperature, duration)

    • Try alternative expression systems (mammalian, insect cells) for improved folding

    • Consider fusion partners (beyond His-tag) that enhance solubility

    • Verify expression vector sequence integrity

• Reduced Functional Activity:

  • Problem: Expressed protein shows minimal functional responses in [35S]-GTPγS binding assays

  • Troubleshooting:

    • Ensure proper protein reconstitution and storage conditions

    • Verify receptor integrity through ligand binding assays

    • Ensure sufficient G-protein expression in the assay system

    • Check buffer components for potential inhibitory effects

    • Consider the need for membrane preparation rather than soluble protein

• Inconsistent Cell-Based Assay Results:

  • Problem: Variable responses in transfected cell systems

  • Troubleshooting:

    • Standardize transfection efficiency monitoring

    • Optimize cell density and passage number

    • Ensure consistent expression levels between experiments

    • Control for endogenous receptor expression in the cell line

    • Consider stable rather than transient transfection approaches

• Species-Specific Response Differences:

  • Problem: Unexpected differences when comparing pig HTR1D to human variant

  • Troubleshooting:

    • Conduct systematic comparative pharmacology studies

    • Focus on divergent amino acid residues in binding and G-protein coupling domains

    • Use site-directed mutagenesis to identify critical residues

    • Consider species-specific G-protein coupling preferences

• Signaling Pathway Detection Issues:

  • Problem: Difficulty detecting PI3K/Akt pathway activation

  • Troubleshooting:

    • Optimize time points for capturing transient phosphorylation events

    • Ensure use of phospho-specific antibodies with high sensitivity

    • Include positive controls for pathway activation

    • Consider cell-specific variations in signaling coupling efficiency