Recombinant Pig Alpha-1D adrenergic receptor (ADRA1D)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Alpha-1D Adrenergic Receptor (ADRA1D)

The recombinant pig alpha-1D adrenergic receptor (ADRA1D) is a genetically engineered protein derived from the pig genome, designed to study the structural, functional, and pharmacological properties of the alpha-1D adrenergic receptor subtype. ADRA1D belongs to the G protein-coupled receptor (GPCR) family and plays critical roles in vascular smooth muscle contraction, blood pressure regulation, and neurotransmission. Recombinant production enables researchers to bypass limitations of native tissue extraction, allowing controlled studies of receptor-ligand interactions, signaling pathways, and therapeutic targeting .

Structure and Function of ADRA1D

ADRA1D is a transmembrane receptor with seven helical domains, mediating signaling via Gq/11 proteins. Key features include:

  • Gene Structure: Encoded by the ADRA1D gene (chr20p13 in humans), comprising two exons with a single intron .

  • Signaling Mechanism: Activation triggers phospholipase C (PLC) activity, leading to intracellular calcium influx and vasoconstriction .

  • Species-Specific Expression: In pigs, ADRA1D is expressed in vascular tissues and possibly the central nervous system, though precise localization data remain limited .

Production and Applications of Recombinant Pig ADRA1D

Product CodeExpression SystemApplicationsSource
CSB-CF874678PIE. coliBiochemical assays, ligand binding studiesCusabio
CSB-YP874678PIYeastStructural studies, in vivo biotinylationCusabio
CSB-EP874678PIBaculovirusPost-translational modification studiesCusabio

Key Applications:

  • Ligand Screening: Testing selectivity of α₁-adrenergic antagonists (e.g., tamsulosin, cyclazosin) .

  • Signaling Pathway Analysis: Investigating Gq/11-mediated calcium signaling in vascular smooth muscle .

  • Protein-Protein Interaction Studies: Mapping receptor interactions with accessory proteins .

Cardiovascular Regulation

ADRA1D is critical for maintaining systemic blood pressure. Studies in knockout mice (α₁D–/–) revealed:

  • Hypotension: Basal systolic and mean arterial pressure reduced by ~30–40% compared to wild-type mice .

  • Impaired Vasoconstriction: Contractile responses to phenylephrine and norepinephrine diminished in isolated aortic and mesenteric arteries .
    While these studies used murine models, the recombinant pig ADRA1D is instrumental in validating cross-species pharmacological responses .

Neurological and Cognitive Roles

Although α₁D-AR is less abundant in the brain compared to α₁A/α₁B subtypes, it may influence:

  • Neurogenesis: Potential regulation of progenitor cell activity, though evidence remains indirect .

  • Synaptic Plasticity: Modulation of glutamate release, as observed in α₁-AR activation studies .

Comparative Analysis of ADRA1D Across Species

SpeciesExpression TissuesPrimary FunctionsRecombinant Utility
PigVascular smooth muscleBlood pressure regulationIn vitro ligand binding, signaling studies
HumanAorta, prostate, brainVascular tone, cognitionStructure-based drug design
MouseAorta, heart, CNSHypertension models, neurogenesisKnockout studies

Challenges and Future Directions

  • Selectivity Issues: Recombinant ADRA1D is often used alongside subtype-specific antagonists (e.g., BMY 7378) to confirm receptor specificity .

  • Structural Characterization: Limited crystallographic data for ADRA1D necessitates continued reliance on homology modeling .

  • Therapeutic Potential: Targeting ADRA1D may offer novel approaches for hypertension or neurodegenerative diseases, pending further validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRA1D; Alpha-1D adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-571
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MTFRDLLSVNFEGSRSDGSAGGASAGGSGGGSGGAAASEGRAVDGVPGTAGSGGVVGAGS DENNRSSAGEPGAAGAGGEVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSV ACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCT ASILSLCTISVDRYVGVRHSLKYPSIMTERKAAAILALLWAVAIVVSVGPLLGWKEPVPP DERFCGITEEAGYAVFSSLCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASE VVLRIHCRGSSTGTDRGHGAMRSTKGHTFRSSLSLRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CHHSRRRRRPLWRAYGHHWLASNGGPRPDCAPGLGAAPREAPLALPAPEATDTPSAPEAQ APVVGRRKPPYSFRDWRLLGPFRRPTTQLRAKVSSLSQKIRAGSAPCAEAPCALRSEVEA VSLNVPHDAAEGATWQAYELADYSHLRETDI
Uniprot No.

Target Background

Function
This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1D sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ADRA1D and what are its primary signaling mechanisms?

ADRA1D belongs to the G-protein coupled receptor 1 family, specifically in the adrenergic receptor subfamily. This receptor mediates its effects primarily through the influx of extracellular calcium . As a member of the α1-adrenergic receptor family, ADRA1D activates phospholipase C, leading to the formation of inositol trisphosphate and diacylglycerol, which subsequently trigger intracellular calcium release and protein kinase C activation. While human ADRA1D has been extensively characterized, recombinant pig ADRA1D likely shares significant functional homology given the conservation of adrenergic receptors across mammalian species .

The signaling mechanism involves:

  • Ligand binding to the receptor

  • G-protein activation (primarily Gq/11)

  • Stimulation of phospholipase C

  • Generation of second messengers

  • Calcium mobilization from intracellular stores

How does ADRA1D differ structurally and functionally from other α1-adrenergic receptor subtypes?

ADRA1D shows distinct pharmacological properties and tissue distribution compared to other α1-adrenergic receptor subtypes (α1A and α1B). In terms of expression in the central nervous system, studies comparing radioligand binding in α1-receptor knockout mice indicate that ADRA1D constitutes approximately 10% of total α1-adrenergic receptors in the brain, compared to ~55% for α1A and 35% for α1B .

Structurally, ADRA1D belongs to the ADRA1D sub-subfamily within the G-protein coupled receptor 1 family . A key post-translational modification of ADRA1D is palmitoylation, particularly by the enzyme ZDHHC21, which may increase receptor expression and regulate downstream signaling pathways . Functionally, ADRA1D exhibits different pharmacological profiles for various agonists and antagonists compared to other subtypes, as evidenced by differential binding affinities for compounds like BMY7378, which shows higher selectivity for ADRA1D .

What expression systems are most suitable for producing recombinant pig ADRA1D?

For recombinant ADRA1D expression, multiple systems have been employed with varying advantages. Based on the information about human ADRA1D, wheat germ expression systems have been successfully used for producing functional receptor fragments . For pig ADRA1D, the following expression systems would likely be suitable:

  • Mammalian cell lines: HEK293 or CHO cells provide appropriate post-translational modifications and membrane insertion

  • Wheat germ cell-free systems: Effective for producing protein fragments for structural studies and antibody production

  • Baculovirus-insect cell systems: Suitable for larger-scale production with proper folding

  • Yeast expression systems: Beneficial for functional studies requiring membrane insertion

Each system should be optimized for codon usage appropriate for pig-derived sequences to maximize expression efficiency.

How should dose-response experiments be designed for recombinant pig ADRA1D activation studies?

When designing dose-response experiments for recombinant pig ADRA1D, researchers should implement a systematic approach that accounts for receptor pharmacology and assay sensitivity. Based on protocols for human ADRA1D, the following methodology is recommended:

  • Reference compound selection: Use established agonists like L-phenylephrine, cirazoline- HCl, epinephrine, or norepinephrine as positive controls

  • Concentration range: Implement a 7-point treatment series using serial 4-fold dilutions to generate a complete dose-response curve

  • Vehicle control: Include appropriate vehicle controls (e.g., media containing equivalent DMSO concentrations)

  • Replicates: Perform experiments with 2-3 technical replicates per treatment condition

  • Time course: Pre-incubate cells for 4-6 hours prior to treatment and maintain consistent incubation times post-treatment

A typical dilution scheme for dose-response curves would follow this pattern:

Dilution StepFinal ConcentrationVolume Transfer
Stock solution12 mM10 μl
1/200 dilution12,000 nM40 μl into 1990 μl CSM
1/4 dilution3,000 nM300 μl into 900 μl CSM
1/4 dilution750 nM300 μl into 900 μl CSM
1/4 dilution187.5 nM300 μl into 900 μl CSM
1/4 dilution46.8 nM300 μl into 900 μl CSM
1/4 dilution11.7 nM300 μl into 900 μl CSM
1/4 dilution2.93 nM300 μl into 900 μl CSM

This methodical approach ensures comprehensive characterization of agonist potency and efficacy .

What controls are essential when investigating ADRA1D antagonists in cellular assays?

When studying antagonists of recombinant pig ADRA1D, implementing proper controls is critical for generating reliable and interpretable data. Essential controls include:

  • Positive control antagonists: Include well-characterized antagonists such as BMY7378, WB4104, doxazosin mesylate, carvedilol, HEAT hydrochloride, silodosin, or terazosin at varying concentrations

  • EC80 agonist concentration: Co-treat cells with an EC80 concentration of a reference agonist (e.g., L-phenylephrine) to properly evaluate antagonist potency

  • Vehicle control: Include appropriate vehicle controls to account for any solvent effects

  • Cytotoxicity assessment: Perform parallel cytotoxicity assessments (e.g., INDIGO's Live Cell Multiplex Assay) to confirm that observed inhibition is not due to general cytotoxicity

  • Subtype selectivity controls: Include assays with other α1-receptor subtypes (α1A and α1B) to determine antagonist selectivity profiles

  • Time-dependent controls: Assess potential time-dependent effects on antagonist potency

  • Reversibility assessment: Evaluate whether antagonism is reversible or irreversible by washout experiments

These controls ensure that antagonist effects on ADRA1D are specific, concentration-dependent, and not confounded by cytotoxicity or other non-specific effects .

How can post-translational modifications of recombinant pig ADRA1D be assessed?

Post-translational modifications (PTMs) significantly influence ADRA1D function, particularly palmitoylation, which can increase receptor expression and regulate downstream signaling . To assess PTMs in recombinant pig ADRA1D:

  • Mass spectrometry analysis:

    • Use liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify specific modification sites

    • Employ MALDI-TOF to compare molecular weights of modified and unmodified receptors

  • Palmitoylation-specific assays:

    • Metabolic labeling with tritiated palmitate ([3H]-palmitate)

    • Acyl-biotin exchange (ABE) technique for non-radioactive detection

    • Assess ZDHHC21-mediated palmitoylation effects on receptor expression and signaling

  • Phosphorylation analysis:

    • Phospho-specific antibodies for common phosphorylation sites

    • Phosphorylation site mutants (serine/threonine to alanine) to assess functional impacts

    • [32P]-orthophosphate labeling followed by immunoprecipitation

  • Glycosylation assessment:

    • Enzymatic deglycosylation (PNGase F, Endo H) followed by Western blot analysis

    • Lectin-binding assays to characterize glycan structures

    • Site-directed mutagenesis of predicted N-glycosylation sites

These methodologies provide comprehensive characterization of PTMs that may significantly affect receptor trafficking, ligand binding, and signaling efficiency.

What reporter systems are most effective for studying recombinant pig ADRA1D signaling?

When investigating signaling pathways of recombinant pig ADRA1D, several reporter systems offer distinct advantages depending on the specific research questions:

  • Luciferase-based reporter systems:

    • ADRA1D activation can be effectively measured using luciferase reporters coupled to response elements downstream of ADRA1D signaling

    • These systems enable quantification of receptor activation through relative light units (RLU) measurements

    • Benefits include high sensitivity, wide dynamic range, and compatibility with high-throughput screening

  • Calcium flux assays:

    • Since ADRA1D mediates effects through extracellular calcium influx , calcium-sensitive dyes (Fluo-4, Fura-2) provide direct measurement of receptor activation

    • Ratiometric calcium indicators enable real-time kinetic analysis of signaling events

    • These assays are particularly suitable for analyzing temporal aspects of receptor activation

  • BRET/FRET-based systems:

    • Bioluminescence/Fluorescence Resonance Energy Transfer systems allow monitoring of protein-protein interactions

    • Useful for studying G-protein coupling dynamics and β-arrestin recruitment

    • Provide insights into biased signaling properties of different ligands

  • Phospho-specific readouts:

    • Measuring phosphorylation of downstream effectors (ERK1/2, PKC) by immunoblotting

    • AlphaScreen/AlphaLISA technologies for high-throughput quantification of phosphorylation events

    • These approaches connect receptor activation to specific signaling pathways

When selecting a reporter system, researchers should consider temporal resolution requirements, signal-to-noise considerations, and the specific signaling pathway of interest.

How can researchers differentiate ADRA1D responses from other adrenergic receptor subtypes?

Differentiating ADRA1D responses from other adrenergic receptor subtypes presents significant challenges due to overlapping pharmacology. Researchers can implement the following approaches:

  • Subtype-selective compounds:

    • Use subtype-selective antagonists such as BMY7378 (ADRA1D-selective) to pharmacologically isolate receptor subtypes

    • Employ compounds with established selectivity profiles across different concentrations

    • Construct inhibition curves with multiple antagonists to create pharmacological fingerprints

  • Genetic approaches:

    • CRISPR/Cas9-mediated knockout of specific receptor subtypes

    • RNA interference to selectively reduce expression of non-target receptor subtypes

    • Heterologous expression systems expressing only the target receptor subtype

  • Knockout mouse-derived cells:

    • Utilize cells from mice with genetic ablation of specific α1-AR subtypes

    • These systems allow cleaner pharmacological characterization by eliminating compensatory mechanisms

  • Signaling pathway dissection:

    • Exploit potential differences in coupling efficiency to downstream pathways

    • Analyze signaling kinetics, which may differ between receptor subtypes

    • Examine biased signaling properties unique to ADRA1D

  • Quantitative analysis of receptor expression:

    • Use reverse transcription quantitative PCR (RT-qPCR) to measure mRNA levels of different receptor subtypes

    • ELISA or Western blotting with subtype-specific antibodies to quantify protein expression

These strategies, used individually or in combination, enable more precise attribution of observed responses to ADRA1D activation.

How do species differences impact pharmacology between pig and human ADRA1D receptors?

Species differences in ADRA1D pharmacology are critical considerations when translating findings between pig and human models. While the binding and affinity of ligands for α1-AR subtypes show general conservation between humans, mice, and rats , important species-specific differences may exist:

  • Sequence homology and binding pocket variations:

    • Amino acid differences in binding pockets can alter ligand affinity and selectivity

    • Comparative sequence analysis of pig and human ADRA1D should focus on transmembrane domains containing key binding residues

  • Tissue distribution patterns:

    • Expression patterns of ADRA1D may differ between species, affecting physiological relevance

    • In humans, ADRA1D mRNA is expressed in CA1-3 regions of the hippocampus, whereas distribution patterns may differ in pig tissues

  • Signaling pathway coupling:

    • Species differences in G-protein coupling efficiency or β-arrestin recruitment may exist

    • Differential regulation of downstream pathways can result in species-specific pharmacological profiles

  • Pharmacological profiles:

    • EC50/IC50 values for standard compounds should be compared between species

    • Rank order potency of reference compounds may vary between pig and human ADRA1D

A systematic comparative pharmacological approach is recommended, testing a panel of compounds in both species to develop translation factors for accurate interspecies data interpretation.

What are the challenges in developing subtype-selective antibodies for pig ADRA1D?

Developing highly selective antibodies for pig ADRA1D presents several technical challenges:

  • Sequence homology between subtypes:

    • High amino acid sequence similarity between α1-AR subtypes (α1A, α1B, and α1D) makes identifying unique epitopes challenging

    • Transmembrane domains are particularly conserved, limiting potential targeting regions

  • Species-specific considerations:

    • Limited commercial availability of antibodies specifically validated for pig ADRA1D

    • Cross-reactivity testing against all three α1-AR subtypes from pig is essential

  • Validation strategies:

    • Use of receptor knockout tissues or cells as negative controls

    • Recombinant expression of each receptor subtype for specificity testing

    • Multiple epitope targeting to increase confidence in detection specificity

  • Selection of immunogen:

    • Target unique N-terminal sequences (amino acids 1-27) or C-terminal domains

    • Consider using synthetic peptides corresponding to extracellular loops

    • Avoid highly conserved regions shared with other adrenergic receptor subtypes

  • Validation methods:

    • Western blotting with competitive peptide blocking

    • Immunohistochemistry with parallel in situ hybridization

    • Immunoprecipitation followed by mass spectrometry confirmation

Antibody development should focus on the less conserved N-terminal region, which in human ADRA1D includes the sequence MVFLSGNASDSSN CTQPPAPVNISKAI , with appropriate modifications for pig-specific sequences.

How should conflicting pharmacological data for ADRA1D be interpreted?

When encountering conflicting pharmacological data for recombinant pig ADRA1D, researchers should implement a systematic approach to data interpretation:

  • Methodological differences assessment:

    • Compare experimental conditions (buffer composition, temperature, incubation time)

    • Examine cell types used for receptor expression (differences in G-protein expression levels)

    • Evaluate detection methods (luminescence-based vs. calcium flux vs. radioligand binding)

  • Receptor expression level considerations:

    • Quantify receptor expression levels, as these can significantly affect apparent potency

    • Assess potential impact of receptor reserve on functional assays

    • Consider the influence of receptor:G-protein stoichiometry on signaling efficiency

  • Allosteric modulators and interacting proteins:

    • Investigate the presence of endogenous allosteric modulators in different systems

    • Consider differences in expression of scaffolding or regulatory proteins

    • Examine potential receptor heteromerization with other GPCRs

  • Statistical approach:

    • Apply meta-analysis techniques to conflicting datasets

    • Weight studies based on methodological rigor and reproducibility

    • Consider Bayesian approaches to integrate multiple data sources

  • Reconciliation strategies:

    • Perform side-by-side comparisons under identical conditions

    • Develop mathematical models that account for methodological differences

    • Consider the possibility that multiple observations are correct under their specific conditions

This systematic approach helps distinguish genuine biological variability from methodological artifacts in conflicting ADRA1D pharmacological data.

What are the optimal assay conditions for studying recombinant pig ADRA1D activation?

Establishing optimal assay conditions is crucial for obtaining reliable data from recombinant pig ADRA1D studies. Based on protocols for human ADRA1D, the following conditions are recommended:

  • Cell culture conditions:

    • Maintain cells at 37°C with ≥70% humidity and 5% CO2

    • Pre-incubate reporter cells for 4-6 hours before compound treatment

    • Use serum-free or low-serum media during assays to minimize interference

  • Buffer and reagent considerations:

    • Use Compound Screening Medium (CSM) for preparation of treatment solutions

    • Limit organic solvent (e.g., DMSO) concentration to <0.4% to avoid non-specific effects

    • Prepare fresh dilutions of test compounds immediately before assay

  • Assay execution parameters:

    • Dispense 200 μl of treatment media per well for consistent exposure

    • Implement a 7-point serial dilution series with 4-fold dilution steps for dose-response curves

    • Include appropriate positive controls (L-phenylephrine) and negative controls

  • Detection considerations:

    • For luminescence-based detection, optimize plate reader settings for maximum sensitivity

    • For calcium flux assays, establish appropriate baseline periods and sampling rates

    • Consider the temporal aspects of ADRA1D signaling when determining measurement timepoints

  • Data normalization:

    • Calculate fold-activation relative to vehicle control

    • Determine Z' values to assess assay quality and robustness

    • Apply appropriate curve-fitting models (four-parameter logistics) for EC50 determination

These optimized conditions facilitate reproducible, high-quality data generation for characterizing recombinant pig ADRA1D pharmacology.

How can researchers optimize Western blot protocols for detecting recombinant pig ADRA1D?

Optimizing Western blot protocols for detecting recombinant pig ADRA1D requires addressing several technical considerations:

  • Sample preparation:

    • Use mild detergents (0.5-1% DDM, CHAPS, or Triton X-100) for membrane protein solubilization

    • Include protease inhibitors to prevent degradation during extraction

    • Avoid boiling samples, which can cause aggregation of membrane proteins; instead, incubate at 37°C for 30 minutes

  • Gel electrophoresis optimization:

    • Employ gradient gels (4-15% or 4-20%) to improve resolution

    • Use reducing conditions (β-mercaptoethanol or DTT) to disrupt potential disulfide bonds

    • Load appropriate protein amounts (15-30 μg total protein per lane)

  • Transfer conditions:

    • Implement wet transfer methods for more efficient transfer of membrane proteins

    • Use lower methanol concentrations (10%) in transfer buffer to improve transfer efficiency

    • Consider longer transfer times (overnight at low voltage) for complete transfer

  • Detection strategies:

    • Block with 5% BSA rather than milk to reduce background

    • Incubate primary antibodies at 4°C overnight for improved specificity

    • Use high-sensitivity detection methods (enhanced chemiluminescence or fluorescent secondaries)

  • Controls and validation:

    • Include positive controls such as recombinant human ADRA1D or transfected cell lysates

    • Perform peptide competition assays to confirm specificity

    • Use lysates from cells expressing related subtypes (α1A, α1B) to assess cross-reactivity

  • Expected results:

    • The predicted molecular weight of unmodified ADRA1D is approximately 60 kDa

    • Glycosylated forms may appear at higher molecular weights (70-80 kDa)

    • Potential detection of SDS-resistant dimers at approximately 120-130 kDa

An optimized protocol increases detection sensitivity and specificity, facilitating accurate quantification and characterization of recombinant pig ADRA1D.

What statistical approaches are most appropriate for analyzing ADRA1D signaling kinetics?

Analysis of ADRA1D signaling kinetics requires sophisticated statistical approaches to capture temporal dynamics and parameter estimation:

  • Non-linear regression models:

    • Apply the least-squares method of non-linear regression for dose-response relationships

    • Use four-parameter logistic models to determine EC50/IC50 values and Hill slopes

    • Consider biphasic models if responses suggest multiple binding sites or signaling pathways

  • Kinetic parameter estimation:

    • Implement compartmental models to estimate rate constants for calcium mobilization

    • Use area under the curve (AUC) analysis for integrated responses over time

    • Apply maximum response (Emax) and time to peak (tmax) as key temporal parameters

  • Comparison between conditions:

    • Use repeated measures ANOVA for time-course comparisons between treatments

    • Apply two-way ANOVA to assess interactions between drug concentration and time

    • Implement mixed-effects models to account for inter-experimental variability

  • Quality control metrics:

    • Calculate Z' factor to assess assay quality and separation between positive and negative controls

    • Determine signal-to-background ratios for assay optimization

    • Use coefficient of variation (CV) to assess reproducibility across replicates

  • Advanced analytical approaches:

    • Consider Bayesian hierarchical modeling for complex datasets

    • Apply principal component analysis for multivariate response data

    • Implement operational models of agonism to separate affinity from efficacy parameters

These statistical approaches enable rigorous quantification of ADRA1D signaling dynamics, facilitating mechanistic insights and accurate pharmacological characterization.

How can recombinant pig ADRA1D research inform human neurological disease studies?

Recombinant pig ADRA1D research offers valuable insights for human neurological diseases through several translational pathways:

  • Comparative pharmacology for CNS disorders:

    • α1-ARs, including ADRA1D, regulate neuronal excitability and synaptic plasticity relevant to cognitive disorders

    • Studies in pig models can inform therapeutic approaches for conditions like Alzheimer's disease, given the role of α1A-ARs in hippocampal regulation

    • The relatively high α1-AR content in human hippocampus and prefrontal cortex suggests translational relevance of findings

  • Neurogenesis and neuroplasticity:

    • α1-ARs regulate neurogenesis in the hippocampus, particularly through the α1A subtype

    • While the role of ADRA1D is less prominent than α1A in neurogenesis, comparative studies between subtypes inform understanding of receptor-specific effects

    • Pig models allow investigation of how ADRA1D modulates neural repair mechanisms relevant to neurodegeneration

  • Synaptic transmission regulation:

    • α1-ARs influence NMDA-dependent synaptic plasticity through enhancement of inositol tri-phosphate mediated calcium release

    • ADRA1D's role in calcium influx suggests involvement in synaptic function regulation

    • Pig studies can elucidate subtype-specific contributions to long-term potentiation and paired-pulse facilitation

  • Pharmaceutical development considerations:

    • Species differences in receptor distribution must be accounted for when translating findings

    • Higher expression of ADRA1D mRNA in human hippocampal CA1-3 regions compared to rodents suggests potential translational challenges

    • Pig ADRA1D studies may bridge rodent-human translation gaps for CNS drug development

These translational applications highlight the value of recombinant pig ADRA1D research for understanding human neurological diseases and developing targeted therapeutics.

What are best practices for comparing ADRA1D sequence and function across species?

Comparing ADRA1D sequence and function across species requires systematic approaches to identify conserved elements and species-specific differences:

  • Sequence alignment and analysis:

    • Perform multiple sequence alignment of ADRA1D from pig, human, and other relevant species

    • Focus on transmembrane domains and ligand-binding residues for functional correlation

    • Calculate percent identity and similarity in key functional domains

    • Identify species-specific amino acid substitutions in critical regions

  • Structural modeling approaches:

    • Generate homology models based on crystal structures of related GPCRs

    • Perform in silico docking studies with known ligands across species variants

    • Identify potential species-specific binding pocket differences

    • Validate structural predictions with site-directed mutagenesis

  • Functional comparisons:

    • Conduct side-by-side pharmacological characterization using identical assay conditions

    • Compare EC50/IC50 values for a panel of reference agonists and antagonists

    • Assess G-protein coupling preferences and signaling bias across species

    • Investigate calcium signaling dynamics, given ADRA1D's role in calcium influx

  • Expression pattern analysis:

    • Compare tissue distribution patterns between species using RT-qPCR or RNA-seq

    • Examine developmental regulation of expression across species

    • Investigate co-expression with interacting proteins

    • Species differences in hippocampal distribution patterns may be particularly relevant

  • Translational correlation:

    • Develop mathematical models to translate pharmacological parameters between species

    • Identify conserved pharmacophores that maintain activity across species

    • Establish allometric scaling factors for dose translation in preclinical studies

These systematic approaches enable informed translation of findings between pig and human ADRA1D research, enhancing the predictive value of preclinical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.