Recombinant Pig Alpha-2A adrenergic receptor (ADRA2A)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The ADRA2A gene encodes a 450-amino-acid protein with seven transmembrane domains, characteristic of G protein-coupled receptors (GPCRs) . Notably, the gene lacks introns in both coding and untranslated regions, simplifying recombinant production . In pigs, ADRA2A shares structural homology with human and rodent orthologs but exhibits species-specific variations in ligand-binding affinity, particularly in the fifth transmembrane domain .

FeatureDetails
GeneADRA2A (intron-less)
Protein Length450 amino acids (porcine)
Transmembrane Domains7 (critical for ligand binding and G protein coupling)
Post-Translational TagsHis-tag (N-terminal) for purification and detection in recombinant proteins

Functional Roles

ADRA2A regulates presynaptic inhibition of neurotransmitter release in sympathetic nerves and central noradrenergic neurons. In pigs, it mediates endothelium-dependent vascular relaxation and modulates catecholamine-induced responses in coronary arteries . Key functions include:

  • Neurotransmitter Regulation: Inhibits norepinephrine release at high stimulation frequencies .

  • Vascular Tone Control: Mediates vasodilation via endothelial nitric oxide synthase activation .

  • Species-Specific Activity: Porcine ADRA2A exhibits pharmacological differences from rodent α2D receptors, affecting ligand selectivity .

Recombinant Production and Applications

Recombinant pig ADRA2A is produced via heterologous expression systems, primarily in E. coli or mammalian cells. Below are key products and their specifications:

Recombinant ADRA2A Products

ProductSourceTagPurityApplications
RFL-22175SF (Creative BioMart)E. coliN-terminal His>90% (SDS-PAGE)SDS-PAGE, ligand-binding assays
ADRA2A-3331P (Creative BioMart)E. coliHis-tagged>90% (SDS-PAGE)Structural studies, antibody production
ADRA2A ELISA Kit (Assay Genie)Quantifying ADRA2A in pig serum/plasma

Key Applications:

  • Structural Studies: His-tagged proteins enable purification and crystallization for X-ray crystallography .

  • Ligand Binding Assays: Recombinant ADRA2A is used to test agonists (e.g., clonidine, dexmedetomidine) and antagonists (e.g., yohimbine, atipamezole) .

  • Disease Modeling: ELISA kits measure ADRA2A levels in porcine models of hypertension or cardiovascular disorders .

Ligand Interactions

ADRA2A binds a range of adrenergic compounds, with species-specific affinities:

Ligand TypeExamplesRelevance
AgonistsClonidine, Dexmedetomidine, GuanfacineTherapeutic agents for hypertension, sedation
AntagonistsYohimbine, Idazoxan, AtipamezoleReversing sedation in veterinary medicine

Note: Porcine ADRA2A exhibits reduced sensitivity to yohimbine compared to rodent α2D receptors .

Species-Specific Variations

SpeciesReceptor SubtypeLigand Sensitivity
Humanα2AHigh affinity for yohimbine
Pigα2AModerate affinity for yohimbine
Rodentα2DLow affinity for yohimbine

Research Implications

  1. Cardiovascular Research: Porcine ADRA2A models are critical for studying endothelial function and hypertension .

  2. Neurological Applications: ADRA2A’s role in presynaptic regulation informs treatments for ADHD and anxiety disorders .

  3. Drug Development: Recombinant ADRA2A aids in screening α2-adrenergic agonists/antagonists for veterinary and human use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADRA2A; A2AR; Alpha-2A adrenergic receptor; Alpha-2A adrenoreceptor; Alpha-2A adrenoceptor; Alpha-2AAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MGSLQPEAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGG QQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAAA ALPGGAERRPNGLGPERGVGRVGAEAEPLPVQLNGAPGEPAPAGPRDADGLDLEESSSSE HAERPPGPRRSERGPRAKSKARASQVKPGDSLPRRGPGAPGPGAPATGAGEERGGVAKAS RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSS LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Uniprot No.

Target Background

Function

Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase via G protein signaling.

Gene References Into Functions
  1. Islet cells express mRNA transcripts for sulfonylurea receptor 1 (SUR1), inward rectifying potassium channel (Kir6.2, associated with SUR1), glucagon-like peptide 1 receptor (GLP1R), and adrenergic receptor alpha 2A (ADRA2A). PMID: 24801676
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2A sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of pig ADRA2A compared to other species?

Pig Alpha-2A adrenergic receptor (ADRA2A) belongs to the G protein-coupled receptor superfamily and shares high sequence homology with human, mouse, and rat orthologs. The receptor consists of seven transmembrane domains with an observed molecular weight of approximately 45-51 kDa . Functionally, ADRA2A mediates catecholamine-induced inhibition of adenylate cyclase through G protein interactions, specifically by coupling to the inhibitory G-alpha subunit (Gi) that suppresses adenylyl cyclase activity .

The key functional region of ADRA2A includes the 3rd intracellular loop, which contains the highly conserved sequence R(218) I Y Q I A K R R T R V P P S R R G(235) across human, mouse, rat, and porcine species . This conservation suggests that pig ADRA2A likely maintains similar signaling mechanisms to those documented in other mammalian models.

What are the primary physiological roles of ADRA2A in the porcine system?

Based on research across species, pig ADRA2A likely plays several critical physiological roles:

  • Neurotransmission regulation: ADRA2A inhibits the flow of sympathetic nerves in the central nervous system, particularly at high stimulation frequencies

  • Cardiovascular function: The receptor is associated with heart diseases, hypertension, hypotension, bradycardia, and tachycardia in multiple species, suggesting similar cardiovascular regulatory roles in pigs

  • Neurological processes: ADRA2A contributes to sedation, anxiolysis, and antinociception (pain reduction)

  • Homeostatic balance: The receptor participates in multiple regulatory pathways including adrenaline signaling and G-protein coupled receptor downstream signaling

Porcine models are valuable for translational research due to their physiological similarities to humans, though species-specific differences in receptor distribution and sensitivity may exist.

What expression systems are most effective for producing functional recombinant pig ADRA2A?

The selection of expression systems for recombinant pig ADRA2A production significantly impacts protein functionality, yield, and post-translational modifications. Based on established methodologies for ADRA2A from other species, researchers should consider:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential improper foldingStructural studies, antibody generation
YeastModerate yield, some post-translational modificationsMay have glycosylation patterns different from mammalsFunctional studies requiring basic modifications
Baculovirus/insect cellsGood yield, mammalian-like post-translational modificationsHigher cost, longer production timeLigand binding assays, signaling studies
Mammalian cellsNative-like post-translational modifications, proper foldingLower yield, highest costCell signaling studies, drug discovery applications

For most functional studies of pig ADRA2A, baculovirus or mammalian expression systems are recommended as they better preserve the native conformation of G protein-coupled receptors, which is critical for maintaining proper ligand binding properties and downstream signaling functions .

How should researchers optimize solubilization and purification protocols for recombinant pig ADRA2A?

Optimizing solubilization and purification of recombinant pig ADRA2A requires careful consideration of membrane protein properties:

  • Membrane extraction: Use a two-step solubilization approach:

    • Initial treatment with mild detergents (0.5-1% DDM or LMNG)

    • Followed by lipid reconstitution for stabilization

  • Purification strategy:

    • Affinity chromatography using tags (His-tag, FLAG-tag) as the capture step

    • Size exclusion chromatography for further purification

    • Consider using stabilizing ligands during purification to maintain the native conformation

  • Buffer optimization:

    • Include 20-30% glycerol to prevent protein aggregation

    • Maintain pH between 7.0-7.5

    • Include cholesterol hemisuccinate (CHS) at 0.1-0.2% to stabilize the receptor

  • Quality control parameters:

    • Assess purity by SDS-PAGE (expected band ~45-51 kDa)

    • Confirm identity via Western blot with specific antibodies

    • Verify functionality through ligand binding assays

This methodological approach balances protein yield with maintenance of functional integrity necessary for downstream research applications.

How does pig ADRA2A differ from human, mouse, and rat ADRA2A in ligand binding profiles?

While the core structure of ADRA2A is conserved across species, subtle differences in ligand binding profiles exist:

Ligand TypeHuman ADRA2APig ADRA2A*Mouse/Rat ADRA2AKey Implications
AgonistsOxymetazoline > clonidine > epinephrine > norepinephrineSimilar to human, with potential differences in potencySimilar rank order with different EC50 valuesDose adjustments may be needed when translating from rodent to pig models
AntagonistsYohimbine > phentolamine = mianserine > chlorpromazineGenerally conserved antagonist profileSlightly different affinities for some antagonistsSpecies-specific validation recommended for antagonist studies
Species-specific compoundsReference standardLimited data on pig-specific compoundsMore extensive characterizationNeed for careful cross-species validation

*Note: The specific binding characteristics of pig ADRA2A are inferred from the high sequence conservation in the binding domain across species .

Research implications: When designing experiments with recombinant pig ADRA2A, researchers should perform validation studies with a panel of reference ligands to establish the precise pharmacological profile before proceeding with novel compound testing.

What are the key differences in ADRA2A signaling pathways between pigs and other model organisms?

ADRA2A signaling mechanisms show both conservation and divergence across species:

  • Conserved signaling elements:

    • G-protein coupling to Gi/Go proteins

    • Inhibition of adenylyl cyclase

    • Reduction in cAMP levels

    • Modulation of calcium and potassium channels

  • Potential species variations:

    • Differential G-protein subtype coupling efficiency

    • Species-specific regulatory mechanisms (phosphorylation, desensitization)

    • Tissue-specific expression patterns and densities

    • Interaction with ancillary proteins and signaling scaffolds

  • Methodological considerations:

    • Use of species-matched G-proteins in reconstituted systems

    • Validation of downstream signaling components

    • Consideration of tissue context when extrapolating findings

While the primary signaling mechanism involving inhibition of adenylyl cyclase is conserved across species , researchers should account for potentially different regulatory mechanisms and receptor densities when designing experiments and interpreting results from pig models.

How can CRISPR-Cas9 gene editing be optimized to study pig ADRA2A function in primary cell cultures?

CRISPR-Cas9 gene editing offers powerful approaches for studying pig ADRA2A function:

  • Guide RNA design strategy:

    • Target conserved functional domains (e.g., G-protein binding regions)

    • Design at least 3-4 gRNAs per target region

    • Avoid regions with high sequence similarity to ADRA2B and ADRA2C

    • Utilize porcine-specific genome databases for off-target prediction

  • Delivery optimization for primary porcine cells:

    • For neurons and cardiomyocytes: Nucleofection typically yields 30-45% efficiency

    • For primary fibroblasts: Lipid-based transfection (60-70% efficiency)

    • Consider lentiviral delivery for difficult-to-transfect cells

  • Validation methodology:

    • Genomic verification: T7E1 assay and sequencing

    • Protein level confirmation: Western blot using specific antibodies

    • Functional validation: Calcium flux assays, cAMP measurement

    • Off-target analysis: Whole genome sequencing of edited lines

  • Phenotypic analysis approaches:

    • Electrophysiology for neuronal cultures

    • Contractility measurements for cardiomyocytes

    • Receptor trafficking using fluorescent-tagged constructs

    • Signaling pathway analysis with phospho-specific antibodies

This comprehensive gene editing strategy enables precise investigation of ADRA2A function in physiologically relevant porcine cell systems.

What are the best approaches to investigate ADRA2A-mediated signaling kinetics in pig models compared to human systems?

Investigating ADRA2A signaling kinetics requires sophisticated methodological approaches:

  • Real-time signaling analysis methods:

    • BRET/FRET biosensors for G-protein activation (resolution: 50-100ms)

    • cAMP dynamics: EPAC-based sensors (temporal resolution: 1-5s)

    • Calcium imaging: GCaMP sensors (temporal resolution: 100-500ms)

    • Membrane potential: Voltage-sensitive dyes (resolution: 1-10ms)

  • Comparative experimental design:

    • Parallel testing in pig and human cell systems under identical conditions

    • Use of species-matched components when reconstituting signaling systems

    • Careful selection of stimulation protocols (dose, duration, pulsatile vs. sustained)

    • Multi-parameter data acquisition to capture signaling complexity

  • Analytical approaches for comparative kinetics:

    • Curve fitting to determine activation/deactivation rate constants

    • Area-under-curve analysis for integrated responses

    • Principal component analysis for pathway discrimination

    • Mathematical modeling to predict species differences in complex signaling networks

  • Translation to physiological contexts:

    • Ex vivo tissue preparations (cardiac, neural, vascular)

    • Optogenetic or chemogenetic control of receptor activation

    • Correlation of signaling kinetics with physiological readouts

This methodological framework enables rigorous comparison of ADRA2A signaling dynamics between pig and human systems, providing insights into species-specific differences relevant for translational research .

How can researchers resolve discrepancies in ADRA2A functional assay results between recombinant systems and native tissues?

Discrepancies between recombinant and native ADRA2A functional responses are common challenges requiring systematic troubleshooting:

  • Common sources of discrepancy:

    • Expression level differences (typically higher in recombinant systems)

    • Absence of native regulatory proteins in recombinant systems

    • Different membrane lipid compositions affecting receptor conformation

    • Post-translational modification variations

  • Systematic troubleshooting approach:

IssueDiagnostic TestSolution StrategyExpected Outcome
Altered pharmacologyCompare EC50/IC50 values across systemsMatch expression levels; include key regulatory proteinsConvergence of dose-response curves
Different signaling efficiencyMeasure G-protein coupling directly (GTPγS binding)Reconstitute with native G-protein subtypesSimilar coupling efficiency
Altered desensitizationTime-course stimulation with β-arrestin recruitment assayInclude GRKs and arrestins in recombinant systemComparable desensitization kinetics
Differential subcellular localizationImmunofluorescence microscopyEngineer trafficking signals; optimize membrane compositionSimilar receptor distribution patterns
  • Normalization strategies:

    • Use relative efficacy rather than absolute response values

    • Establish internal standards active in both systems

    • Derive correction factors for specific experimental parameters

    • Employ mathematical modeling to account for system differences

By implementing this systematic approach, researchers can better align recombinant pig ADRA2A functional profiles with native tissue responses, increasing translational relevance of their findings .

What are the critical considerations when interpreting cross-species differences in ADRA2A-mediated effects?

Interpreting cross-species differences in ADRA2A function requires careful consideration of multiple factors:

  • Sequence-function relationship analysis:

    • Identify species-specific amino acid differences in functional domains

    • Assess conservation in the third intracellular loop region (R218-G235)

    • Evaluate sequence variations in ligand binding pockets

    • Consider differences in regulatory sites (phosphorylation, glycosylation)

  • Expression pattern differences:

    • Map receptor distribution across tissues in different species

    • Quantify expression levels in homologous tissues

    • Evaluate developmental regulation patterns

    • Assess co-expression with interacting proteins

  • Physiological context considerations:

    • Account for differences in autonomic nervous system regulation

    • Consider variations in metabolic rates affecting ligand availability

    • Evaluate compensatory mechanisms (redundancy, adaptation)

    • Assess species differences in relevant disease models

  • Data interpretation framework:

    • Distinguish pharmacological from physiological differences

    • Consider allometric scaling where appropriate

    • Evaluate the impact of experimental conditions on species differences

    • Use multiple approaches to confirm species-specific effects

By systematically addressing these considerations, researchers can better interpret whether observed differences represent fundamental species variations in ADRA2A biology or artifacts of experimental design, leading to more accurate translation between pig models and human applications .

How can single-cell technologies advance our understanding of pig ADRA2A heterogeneity across tissues?

Single-cell technologies offer unprecedented opportunities to characterize ADRA2A heterogeneity:

  • Recommended methodological approaches:

    • Single-cell RNA-seq to map expression patterns across cell types

    • Single-cell ATAC-seq to identify regulatory elements controlling expression

    • Single-cell proteomics to quantify receptor abundance and modifications

    • Spatial transcriptomics to maintain tissue context information

  • Key research questions addressable with these technologies:

    • Cell type-specific expression patterns across pig tissues

    • Correlation between ADRA2A expression and functional specialization

    • Identification of novel cell populations with unique ADRA2A signaling properties

    • Developmental trajectories of ADRA2A-expressing cells

  • Data integration strategies:

    • Multi-modal data fusion algorithms to correlate expression with function

    • Trajectory inference to map developmental and state transitions

    • Cross-species integration to identify conserved and divergent patterns

    • Network analysis to place ADRA2A in tissue-specific signaling contexts

This single-cell approach will provide a comprehensive map of ADRA2A distribution and function across pig tissues, revealing cellular heterogeneity relevant to both basic research and translational applications .

What are the most promising approaches to study ADRA2A involvement in porcine disease models relevant to human health?

Porcine disease models offer valuable platforms for studying ADRA2A's role in human-relevant conditions:

  • Cardiovascular disease models:

    • Hypertension: Telemetric monitoring combined with ADRA2A-targeted interventions

    • Heart failure: Echocardiography with tissue-specific receptor knockdown

    • Arrhythmias: Electrophysiological mapping with optical recording technologies

  • Neuropsychiatric condition models:

    • Stress responses: HPA axis function with ADRA2A modulation

    • Anxiety: Behavioral assessment with receptor-specific compounds

    • Pain processing: Quantitative sensory testing with targeted interventions

  • Methodological innovations:

    • AAV-mediated gene transfer for tissue-specific manipulation

    • Inducible gene modification systems for temporal control

    • Bioimaging techniques for longitudinal receptor tracking

    • Pharmacological probes with improved subtype selectivity

  • Translational validation strategies:

    • Parallel studies in pig tissues and human samples

    • Pharmacological cross-validation between species

    • Computational modeling to predict cross-species translation

    • Biomarker development for monitoring ADRA2A engagement

These approaches leverage the physiological similarities between pigs and humans to develop more predictive models of ADRA2A involvement in disease, potentially accelerating therapeutic development for conditions associated with adrenergic dysregulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.