Recombinant Pig Aquaporin-3 (AQP3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Swine Physiology

Recombinant AQP3 is instrumental in studying:

Intestinal Health:

  • Regulates water absorption and barrier integrity in porcine intestinal epithelial cells (e.g., IPEC-J2) .

  • Downregulation correlates with porcine epidemic diarrhea virus (PEDV) infection severity, increasing viral replication .

  • Methylation of the AQP3 promoter (e.g., mC-20 and mC-10 sites) reduces expression during PEDV-induced diarrhea .

Adipogenesis:

  • Facilitates glycerol transport in porcine intramuscular adipocytes.

  • Silencing AQP3 via siRNA suppresses lipid accumulation and adipogenic markers (e.g., PPARγ, aP2) by inhibiting Akt phosphorylation .

Immune Modulation:

  • Mediates hydrogen peroxide transport, influencing NLRP3-inflammasome activation and NF-κB signaling in intestinal inflammation .

Key Research Findings

Recent studies utilizing recombinant or native Pig AQP3 include:

Study FocusKey OutcomeReference
PEDV pathogenesisAQP3 knockdown increases PEDV replication in IPEC-J2 cells by 2.5-fold .
Promoter methylationMethylation at CpG1 and CpG2 sites reduces AQP3 expression during diarrhea .
Adipocyte differentiationAQP3 deletion reduces EdU-positive cell counts by 40% in intramuscular adipocytes .

Applications in Biotechnology

  • Antibody Development: Commercial polyclonal antibodies (e.g., ab125219) target recombinant Pig AQP3 for immunoblotting and immunohistochemistry .

  • Diagnostic Tools: Used to quantify AQP3 in serum samples, correlating with intestinal barrier function in piglets .

  • Therapeutic Targets: Explored for enhancing cryotolerance in sperm (via AQP3 relocation) and mitigating diarrhea in livestock .

Challenges and Future Directions

  • Species-Specific Variability: AQP3 localization differs across mammals (e.g., midpiece in bull vs. principal piece in pig sperm) .

  • Regulatory Complexity: Interactions with transcription factors (e.g., Sp1, CEBPA) and epigenetic modifications require further study .

  • Industrial Scalability: Optimizing recombinant production in cost-effective systems like E. coli remains a priority .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
AQP3; Aquaporin-3; Aquaglyceroporin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
AQP3
Target Protein Sequence
MGRQKELVTRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYTLAQTLGAFLGAGIIFGLYYDAIWAFANNQLIVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTASLIVCVLAIVDPNNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTAIAGWGSEVFTTGRHWWWVPIASPLLGSIAGVFVYQLMIGCHLEPPPPSTDEENVKLSQVKHKE
Uniprot No.

Target Background

Function
Aquaporin-3 (AQP3) is a water channel protein essential for facilitating glycerol permeability and water transport across cell membranes. In the skin, it functions as a glycerol transporter, playing a crucial role in regulating stratum corneum (SC) and epidermal glycerol content, thereby influencing skin hydration, wound healing, and tumorigenesis. In the kidney medullary collecting duct, AQP3 enables high water permeability, directing water movement along osmotic gradients. Its slight permeability to urea suggests a potential role in water and urea excretion during antidiuresis in collecting duct cells. Furthermore, AQP3 may contribute significantly to gastrointestinal water transport and glycerol metabolism.
Gene References Into Functions
  1. While AQP3 exhibits distinct localization patterns in boar spermatozoa, its content and localization are not correlated with standard sperm parameters. PMID: 26677911
  2. Increased expression of AQP1, AQP2, AQP3, and V2R with gestational age in fetal kidneys suggests a role in the maturation of urinary concentrating capacity. PMID: 27089501
  3. The full-length coding sequences of porcine (Sus scrofa) AQP3, 7, and 9, along with the genomic sequence of AQP3 (including 6 exons and 5 introns), have been cloned. PMID: 18249020
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in stomach and spleen, with lower expression in kidney and lung.

Q&A

Basic Research Questions

  • What is porcine Aquaporin-3 (AQP3) and what are its primary functions in pigs?

    Porcine Aquaporin-3 (AQP3) is a water channel protein belonging to the aquaglycerin subfamily of aquaporins. It functions as a homotetramer on cell membranes, forming funnel-shaped pores that facilitate the rapid transport of small solutes including water, glycerol, and urea across the osmotic gradient . In pigs, AQP3 plays a crucial role in intestinal water absorption and secretion, maintaining intestinal water balance, and supporting intestinal barrier function . Research has also demonstrated AQP3's involvement in cell migration, proliferation, and regulation of intestinal epithelial cell renewal and repair .

  • How is AQP3 expression distributed across porcine intestinal tissues?

    AQP3 is predominantly expressed in the small and large intestines of pigs. Studies have shown that AQP3 is expressed in both the apical and basolateral membranes of intestinal epithelial cells, with expression patterns varying by intestinal segment . In rats (used as a model with similar expression patterns), AQP3 is expressed at both the apical and basal sides of mucosal epithelial cells in the colon, making it the dominant AQP subtype in the luminal side of colon mucosa compared to AQP4 and AQP8 . In pigs, expression levels can change in response to developmental stage, physiological conditions, and pathological challenges such as viral infections .

  • What methods are most effective for detecting porcine AQP3 expression?

    Several complementary methods are recommended for comprehensive detection of porcine AQP3:

    MethodApplicationSensitivityNotes
    qPCRmRNA quantificationHighDetects transcriptional changes
    Western blottingProtein detectionModerateDetermines protein abundance
    ImmunohistochemistryTissue localizationModerateReveals cellular distribution patterns
    Bisulfite sequencing PCRMethylation analysisHighEvaluates epigenetic regulation
    ChIP-PCRTranscription factor bindingHighIdentifies regulatory mechanisms

    For optimal results, researchers should combine transcript-level analysis (qPCR) with protein-level detection (Western blot, immunohistochemistry) to capture both transcriptional and post-transcriptional regulatory effects .

  • How does recombinant porcine AQP3 differ from native AQP3 in structural properties?

    Recombinant porcine AQP3 maintains the core structural properties of native AQP3, including the ability to form homotetramers. Based on human AQP3 data (which shares high homology with porcine AQP3), the recombinant protein has a predicted molecular weight of approximately 31.4 kDa . When expressing recombinant porcine AQP3, researchers typically add tags such as C-Myc/DDK to facilitate purification and detection . These tags may slightly alter the molecular weight but generally do not affect the fundamental channel properties when proper folding occurs. The recombinant protein maintains the characteristic transmembrane domains and pore-forming regions essential for water and small solute transport .

  • What expression systems are suitable for producing recombinant porcine AQP3?

    Several expression systems have been successfully employed for recombinant AQP3 production:

    • Mammalian cell systems: HEK293T cells are commonly used for expressing functional AQP3, providing proper post-translational modifications and membrane targeting

    • Yeast systems: Pichia pastoris offers advantages for membrane protein expression including aquaporins, with the ability to grow to high cell densities and perform proper protein folding

    • Bacterial systems: E. coli-based systems can be used for high-yield production, though additional refolding steps may be necessary

    For functional studies, mammalian expression systems typically yield the most natively folded and properly localized AQP3 protein, while yeast systems offer a balance between yield and functionality .

Advanced Research Questions

  • How does methylation of the porcine AQP3 promoter region regulate expression during viral infections?

    Methylation of the porcine AQP3 promoter region plays a critical role in regulating gene expression during viral infections, particularly during PEDV infection. Research has identified two key CpG islands in the AQP3 promoter region that undergo increased methylation in the jejunum of PEDV-infected piglets . Specifically:

    • CpG1 (position -1762 to -1463 bp) contains 21 CpG sites, all showing varying degrees of methylation

    • CpG2 (position -295 to 87 bp) contains 26 CpG sites, though only 6 show varying methylation levels

    The mC-20 site in CpG1 and mC-10 site in CpG2 demonstrate significant negative correlation with AQP3 expression . Mechanistically, these methylation events inhibit the binding of the transcription factor Sp1 to the AQP3 promoter, resulting in reduced AQP3 expression . This epigenetic regulation represents a key mechanism by which viral infections can disrupt intestinal water homeostasis by suppressing AQP3 expression.

  • What genetic variants in the porcine AQP3 promoter influence transcriptional regulation and disease resistance?

    A significant genetic variant has been identified in the porcine AQP3 promoter region - a 16 bp insertion mutation (GGGCGGGGTTGCGGGC) found in Large White pigs with frequencies of 49.3% heterozygotes and 31.3% homozygous mutants . Functional analysis using luciferase activity assays demonstrated that this insertion mutation significantly enhances AQP3 transcriptional activity (p < 0.01) .

    The mechanistic basis for this enhanced expression involves the creation of additional binding sites for the transcription factor CEBPA, which promotes AQP3 expression . Importantly, this genetic variant appears to confer increased resistance to PEDV infection, as knockdown studies have shown that reduced AQP3 expression results in increased viral titers and genome copies in intestinal epithelial cells . This suggests that breeding programs selecting for this 16 bp insertion could potentially enhance resistance to PEDV in pig populations.

  • How does gene dosage influence recombinant porcine AQP3 expression levels in heterologous systems?

    Gene dosage has a profound impact on recombinant aquaporin expression levels, including AQP3. Studies with various aquaporin isoforms have demonstrated a strong correlation between recombinant gene copy number and expression levels . When expressing recombinant porcine AQP3, researchers should consider:

    • Using selection methods (such as increasing zeocin concentration in P. pastoris systems) to isolate high-copy-number transformants

    • Implementing qPCR-based methods to accurately determine integrated plasmid copy numbers

    • Considering a two-step antibiotic selection process to recover all recombinant clones initially, followed by selection at higher antibiotic concentrations

    Linear regression analysis has shown high correlation coefficients between gene dosage and recombinant protein expression levels, with clones selected at higher antibiotic concentrations (500-1000 μg zeocin/mL) generally expressing higher levels of recombinant protein compared to those selected at lower concentrations (100 μg/mL) .

  • What is the relationship between AQP3 expression and inflammatory responses during enteric infections in pigs?

    AQP3 plays a complex role in modulating inflammatory responses during enteric infections in pigs. When AQP3 is downregulated (either by viral infection or experimental knockdown), several critical inflammatory pathways are affected:

    • Proinflammatory cytokine expression (IL-6, IL-8, and IL-18) is significantly reduced (p < 0.01) in AQP3 knockdown cells upon PEDV infection

    • Interferon responses (IFN-α and IFN-β) are significantly diminished (p < 0.01) in AQP3-deficient cells

    • Tight junction protein expression (ZO-1) is decreased in AQP3 knockdown cells during PEDV infection

    These findings suggest that AQP3 not only regulates water transport but also participates in innate immune signaling cascades that coordinate inflammatory responses to enteric pathogens. AQP3 appears to modulate both NF-κB activation and NLRP3-inflammasome activation, contributing to the establishment of appropriate inflammatory responses . This dual functionality makes AQP3 a potential therapeutic target for modulating both water homeostasis and immune responses during intestinal infections.

  • What strategies can optimize purification and functional characterization of recombinant porcine AQP3?

    Optimizing purification and functional characterization of recombinant porcine AQP3 requires a multi-faceted approach:

    Purification strategies:

    • Affinity chromatography using anti-DDK columns for tagged recombinant AQP3

    • Conventional chromatography steps for further purification

    • Buffer optimization (25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol has proven effective)

    Functional characterization methods:

    MethodApplicationKey Parameters
    Water permeability assaysFunctional activityOsmotic gradient, rate of volume change
    Glycerol transport assaysSubstrate specificityRadiolabeled glycerol uptake
    Hydrogen peroxide transportSignaling capabilityH₂O₂-sensitive fluorescent probes
    Membrane localizationProper folding/targetingConfocal microscopy with fluorescent tags

    Researchers should note that recombinant AQP3 is sensitive to repeated freeze-thaw cycles, and storage at -80°C with minimal thawing events is recommended for maintaining functionality . For cell culture applications, filtration before use is advised, though some protein loss may occur during this process .

  • How can CRISPR-Cas9 technology be applied to study porcine AQP3 function and regulation?

    CRISPR-Cas9 technology offers powerful approaches for investigating porcine AQP3 function and regulation:

    Targeted modification of endogenous AQP3:

    • Knockout studies in porcine intestinal epithelial cell lines (e.g., IPEC-J2) to assess the impact on water transport, barrier function, and viral susceptibility

    • Precise editing of specific methylation sites (mC-20 in CpG1 and mC-10 in CpG2) to investigate their individual contributions to transcriptional regulation

    • Introduction of the identified 16 bp insertion mutation into cell lines or primary cells to confirm its effect on PEDV resistance

    Modification of regulatory elements:

    • Targeted disruption of transcription factor binding sites (Sp1, CEBPA) to validate their roles in AQP3 expression

    • Engineering of promoter variants to systematically study the contribution of specific regulatory elements

    In vivo applications:

    • Generation of porcine models with specific AQP3 modifications to study intestinal pathophysiology

    • Creation of disease-resistant pig lines through introduction of beneficial AQP3 promoter variants

    When designing CRISPR-Cas9 experiments, researchers should carefully validate guide RNA specificity, assess potential off-target effects, and employ appropriate controls including wild-type and mock-transfected cells.

  • How do post-translational modifications affect porcine AQP3 function during health and disease?

    Post-translational modifications (PTMs) significantly impact porcine AQP3 function, though this area remains less thoroughly explored than transcriptional regulation. Based on available data and studies of AQP3 across species:

    Glycosylation:

    • Human AQP3 undergoes glycosylation, which affects protein stability and membrane targeting

    • Porcine AQP3 likely undergoes similar modifications, particularly in mammalian expression systems

    Phosphorylation:

    • Phosphorylation events can regulate channel gating and membrane trafficking

    • During intestinal inflammation or infection, altered kinase activity may modify AQP3 phosphorylation status

    Methylation:

    • While DNA methylation affects AQP3 expression , protein methylation may also occur and affect function

    Ubiquitination:

    • May control AQP3 turnover rates, particularly during cellular stress responses

    To study these modifications, researchers should employ mass spectrometry-based proteomics approaches, phospho-specific antibodies, and site-directed mutagenesis of putative modification sites. During pathological conditions like PEDV infection, changes in these PTMs may contribute to altered AQP3 function beyond transcriptional regulation.

  • What are the methodological considerations for developing AQP3-targeted therapeutics for porcine enteric diseases?

    Developing AQP3-targeted therapeutics for porcine enteric diseases requires consideration of several methodological approaches:

    Target validation strategies:

    • Verification of AQP3's role in disease pathogenesis through knockout/knockdown studies

    • Confirmation that modulating AQP3 expression or function ameliorates disease outcomes

    • Assessment of potential compensatory mechanisms involving other aquaporins

    Therapeutic approaches:

    • Epigenetic modulators that prevent methylation-induced silencing of AQP3 during infection

    • Small molecule enhancers of transcription factor binding (Sp1, CEBPA) to maintain AQP3 expression

    • Direct AQP3 channel modulators to enhance water and glycerol transport

    • Dietary interventions (such as berberine) that upregulate AQP3 expression during challenge

    Delivery considerations:

    • Intestinal-targeted formulations to maximize local effects

    • Age-specific interventions focusing on neonatal and weaned piglets most susceptible to PEDV

    • Integration with existing management strategies for enteric diseases

    Evaluation metrics:

    • AQP3 expression levels (mRNA and protein)

    • Intestinal barrier function parameters

    • Clinical outcomes including diarrhea severity and dehydration

    • Viral load measurements in treatment versus control groups

    By strategically targeting AQP3 regulation or function, novel therapeutic approaches could improve outcomes in porcine enteric diseases beyond traditional antimicrobial or symptomatic treatments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.