Recombinant Pig Aquaporin-5 (AQP5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AQP5; Aquaporin-5; AQP-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
AQP5
Target Protein Sequence
MKKEVCSLAFLKAVFAEFLATLIFVFFGLASALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAVFYVVAQLVGAIAGAGILYGLAPGNARGNLAVNSLNNNTTPGQAVVVEMILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAAVAAILYFYLLFPNSLSLSERVAVVKGTYESEEDWEEQREERKKTMELTAH
Uniprot No.

Target Background

Function
AQP5 forms a water-specific channel, playing a crucial role in fluid secretion within salivary glands. It is essential for TRPV4 activation induced by hypotonicity and, in conjunction with TRPV4, regulates regulatory volume decrease in salivary epithelial cells. While it appears to have a redundant role in water transport in the eye, lung, and sweat glands, its function in these tissues is less critical.
Gene References Into Functions
Gene References and Functional Studies
  1. Quantitative real-time PCR analysis revealed significantly reduced mRNA levels of AQP1, AQP5, and Na,K-ATPase in PRRSV (Porcine reproductive and respiratory syndrome virus)-infected pig lungs compared to uninfected controls. PMID: 29532265
  2. Results indicate the involvement of steroid hormones (progesterone and estradiol), arachidonic acid derivatives, and cAMP in regulating AQP1 and AQP5 expression and AQP5 distribution in the uterine tissue of pregnant gilts during placentation (days 30-32 of gestation). PMID: 27226190
  3. AQP5 expression is upregulated by progesterone, estradiol, arachidonic acid, forskolin, and cyclic AMP in the uterus during embryo implantation. PMID: 26988150
  4. AQP5 appears to regulate follicular fluid accumulation, under androgen control, and may be a key factor in antral follicle growth. PMID: 26661749
  5. AQP1 and AQP5 are crucial for follicular development in pigs. PMID: 25317682
  6. A functional collaboration exists among various AQPs in water regulation during different uterine phases of the estrous cycle and early pregnancy. PMID: 20828411
  7. AQP1, AQP5, and AQP9 are involved in regulating water homeostasis in the reproductive system of gilts. PMID: 18824632
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin-5 (AQP5) and what are its key characteristics in pigs?

Aquaporin-5 (AQP5) is a member of the aquaporin family of membrane proteins that function as water channels, involved in the bidirectional transfer of water and small solutes across cell membranes. In pigs (Sus scrofa), AQP5 is characterized by the following:

  • Protein length: 265 amino acids

  • Gene ID: 100126278

  • mRNA Refseq: NM_001110424

  • Protein Refseq: NP_001103894

  • Pathway involvement: Salivary secretion

Like other AQP5 proteins, pig AQP5 is widely expressed in multiple organ systems including digestive, renal, respiratory, and reproductive tissues. The protein plays crucial roles in fluid homeostasis in these systems .

How is recombinant pig AQP5 typically produced for research purposes?

Recombinant pig AQP5 is commonly produced using prokaryotic expression systems, with E. coli being the most frequently used host. Alternatively, yeast-based expression systems such as Pichia pastoris can be employed. The production process typically involves:

  • Cloning the AQP5 gene sequence into an expression vector

  • Transformation of host cells (E. coli or yeast)

  • Induction of protein expression

  • Cell lysis and protein extraction

  • Purification using affinity chromatography, often facilitated by tags (commonly His-tag)

  • Quality control assessment including SDS-PAGE and Western blotting

The recombinant protein is generally stored in PBS pH 7.4 with 50% glycerol at -20°C or -80°C for extended stability .

What expression systems are most effective for producing functional recombinant pig AQP5?

Both prokaryotic and eukaryotic expression systems have been used successfully for AQP5 production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coli- Rapid growth
- High yields
- Cost-effective
- Simple culturing
- Lacks post-translational modifications
- May form inclusion bodies
- Refolding often required
>90% purity achievable with optimized protocols
Yeast (P. pastoris)- Post-translational modifications
- Proper membrane protein folding
- Scalable production
- Longer production time
- More complex media requirements
- Gene dosage optimization needed
Expression levels strongly respond to increased gene dosage

Research has demonstrated that for aquaporins including AQP5, increasing gene dosage in P. pastoris significantly enhances expression levels. A two-step antibiotic selection method can be employed to identify high-expressing clones .

How can I verify the identity and purity of recombinant pig AQP5?

Verification of recombinant pig AQP5 identity and purity involves multiple complementary approaches:

  • SDS-PAGE: To assess protein size (expected around 27-28 kDa) and purity (typically >90%)

  • Western blotting: Using specific anti-AQP5 antibodies (such as those reactive with human, mouse, or rat AQP5 that show cross-reactivity with pig AQP5)

  • Mass spectrometry: For sequence verification and identification of any post-translational modifications

  • Functional assays: To verify water channel activity of the purified protein

For Western blotting detection, published protocols recommend antibody dilutions of 1:500-1:2000, with observed molecular weight at approximately 27 kDa .

What strategies can optimize expression of recombinant pig AQP5 when facing poor yields?

Poor yields of recombinant pig AQP5 can be addressed through several optimization strategies:

  • Gene dosage amplification: Systematic research has demonstrated that heterologous expression of aquaporins (including AQP5) responds strongly to increased recombinant gene dosage. Developing a screen for multiple copy integrants should be part of routine optimization when expressing AQP5 in systems like P. pastoris .

  • Promoter optimization: Selection of appropriate promoters (e.g., AOX1 for Pichia, T7 for E. coli) can significantly impact expression levels.

  • Codon optimization: Adapting the pig AQP5 coding sequence to the preferred codon usage of the expression host can enhance translation efficiency.

  • Expression condition optimization:

    • Temperature reduction during induction (typically 16-20°C)

    • Optimal induction timing and inducer concentration

    • Extended expression time with reduced inducer concentration

  • Addressing posttranscriptional limitations: Research with plant aquaporins (AtSIP1;1) has shown that poor expression can stem from posttranscriptional limitations rather than transcription problems. Similar mechanisms may affect pig AQP5 expression .

  • Antibiotic selection strategy: A two-step antibiotic selection process has proven effective for aquaporin expression, where:

    • First selection at lower antibiotic concentration (e.g., 100 μg zeocin/mL)

    • Second selection at higher concentrations (500-1000 μg zeocin/mL)

    This approach recovers all recombinant clones initially and then identifies those with higher expression potential .

How can I accurately determine recombinant gene dosage in my expression system?

Accurate determination of recombinant gene dosage is critical for optimizing AQP5 expression. A robust method based on quantitative PCR (qPCR) has been developed specifically for this purpose:

  • DNA extraction: Isolate genomic DNA from your transformed host cells

  • qPCR setup:

    • Target gene: AQP5 recombinant gene

    • Reference gene: Single-copy housekeeping gene from host organism

    • Standards: Dilution series of plasmid containing the gene of interest

  • Copy number calculation:

    • Normalize target gene amplification against reference gene

    • Compare to standard curve to determine absolute copy number

This method is particularly valuable for P. pastoris expression systems using pPICZ vectors, allowing correlation between expression levels and gene dosage. Research has shown that for aquaporins including AQP5, expression levels correlate positively with copy number, independent of the amount of protein expressed from a single gene copy .

What structural and functional assays are appropriate for characterizing recombinant pig AQP5?

Comprehensive characterization of recombinant pig AQP5 requires multiple assays addressing both structural integrity and functional activity:

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Differential scanning calorimetry (DSC) to determine thermal stability

    • Limited proteolysis to evaluate protein folding

    • Size exclusion chromatography to assess oligomerization state

  • Functional characterization:

    • Proteoliposome water permeability assays

    • Stopped-flow light scattering to measure water transport rates

    • Oocyte swelling assays for water channel activity

    • Reconstitution into artificial membranes for electrophysiological measurements

  • Localization studies:
    When expressing in eukaryotic cells for functional studies:

    • Confocal microscopy to verify membrane localization

    • Cell surface biotinylation to quantify plasma membrane expression

Research has demonstrated that increased expression levels do not appear to compromise protein folding and membrane localization of aquaporins, suggesting that optimized expression systems can maintain functional integrity .

How does recombinant pig AQP5 compare structurally and functionally to human and other mammalian AQP5?

Comparative analysis of pig AQP5 with other mammalian homologs reveals important similarities and differences:

SpeciesSequence Similarity to Pig AQP5Key Structural FeaturesFunctional Differences
HumanHigh (>90% identity)- 265 amino acids
- Conserved NPA motifs
- Similar membrane topology
Minimal functional differences expected due to high conservation
Mouse/RatHigh (~85-90% identity)- Conserved tertiary structure
- Similar glycosylation patterns
Similar water permeability characteristics
BovineHigh (~90% identity)- Conserved channel-forming regionsSimilar biophysical properties

Interestingly, studies have shown that AQP5 undergoes tissue-specific processing, such as C-terminal truncation in lens tissue. This processing appears to be evolutionarily conserved, suggesting functional importance .

What are the key considerations when designing antibodies against recombinant pig AQP5?

Development of antibodies against pig AQP5 requires careful epitope selection and validation strategy:

  • Epitope selection considerations:

    • Extramembrane regions (N or C-terminus) are typically more immunogenic

    • Avoid highly conserved regions if species specificity is required

    • Consider accessibility of epitopes in the native protein conformation

    • Multiple epitopes may be targeted for comprehensive detection

  • Validation requirements:

    • Western blot: Expected molecular weight ~27-28 kDa

    • Positive controls: Pig lung or salivary gland tissue

    • Cross-reactivity testing with other aquaporins

    • Immunohistochemistry on tissues known to express AQP5

  • Application-specific optimization:

    • For Western blotting: 1:500-1:2000 dilution typically effective

    • For immunohistochemistry: 1:2500-1:10000 dilution with antigen retrieval

    • For immunofluorescence: 1:50-1:500 dilution

Commercial antibodies against human AQP5 may cross-react with pig AQP5 due to sequence conservation, but validation is essential before use in critical experiments.

What is the recommended protocol for purifying His-tagged recombinant pig AQP5?

The following protocol is optimized for purification of His-tagged recombinant pig AQP5:

  • Cell lysis:

    • Harvest cells expressing recombinant pig AQP5

    • Resuspend in lysis buffer (PBS pH 7.4 containing protease inhibitors)

    • Lyse cells by sonication or French press

    • Centrifuge at low speed to remove cell debris

    • Ultracentrifuge (100,000 × g, 1 hour) to collect membrane fraction

  • Solubilization:

    • Resuspend membrane fraction in solubilization buffer containing:

      • PBS pH 7.4

      • 2% appropriate detergent (e.g., n-Dodecyl β-D-maltoside)

      • 10% glycerol

      • Protease inhibitors

    • Incubate with gentle rotation at 4°C for 1-2 hours

  • Affinity purification:

    • Equilibrate Ni-NTA resin with binding buffer (PBS pH 7.4, 0.1% detergent, 20 mM imidazole)

    • Incubate solubilized protein with resin for 1-2 hours at 4°C

    • Wash with increasing concentrations of imidazole (20-50 mM)

    • Elute with elution buffer containing 250-500 mM imidazole

  • Post-purification processing:

    • Dialyze against storage buffer (PBS pH 7.4, 50% glycerol)

    • Concentrate if necessary using appropriate molecular weight cutoff

    • Aliquot and store at -20°C or -80°C for extended storage

  • Quality control:

    • Assess purity by SDS-PAGE (>90% purity expected)

    • Confirm identity by Western blot using anti-AQP5 or anti-His antibodies

    • Determine protein concentration

Small volumes of purified AQP5 may occasionally become entrapped in the vial cap during shipment and storage. If necessary, briefly centrifuge the vial to dislodge any liquid in the container's cap .

How can I detect post-translational modifications in recombinant pig AQP5?

Detection and characterization of post-translational modifications (PTMs) in recombinant pig AQP5 requires a multi-technique approach:

  • Mass spectrometry-based approaches:

    • Tandem mass spectrometry (MS/MS) after tryptic digestion

    • Precursor ion scanning for specific modifications

    • Multiple reaction monitoring (MRM) for targeted PTM analysis

    • Electron transfer dissociation (ETD) for labile modifications

  • Phosphorylation detection:

    • Phospho-specific antibodies in Western blotting

    • Phos-tag SDS-PAGE for mobility shift detection

    • 32P metabolic labeling followed by immunoprecipitation

    • Specific kinase assays in vitro

  • Glycosylation analysis:

    • PNGase F or Endo H treatment followed by SDS-PAGE mobility shift analysis

    • Lectin blotting with specific glycan-binding lectins

    • Periodic acid-Schiff (PAS) staining

    • Mass spectrometry with glycopeptide enrichment

Studies with lens tissues have shown that AQP5 undergoes C-terminal truncation in the lens core, which may be a specific post-translational processing event. Similar processing may occur in recombinant systems and should be monitored .

What approaches can resolve protein aggregation issues with recombinant pig AQP5?

Aggregation is a common challenge with membrane proteins like AQP5. The following approaches can help resolve aggregation issues:

  • Optimization of expression conditions:

    • Reduce expression temperature (16-20°C)

    • Use milder induction conditions

    • Co-express with molecular chaperones

  • Solubilization and purification optimization:

    • Screen multiple detergents (DDM, OG, LDAO, Fos-choline)

    • Test detergent mixtures or novel amphipathic agents

    • Add stabilizing agents (glycerol, specific lipids, cholesterol)

    • Include additives like arginine or specific ions

  • Buffer optimization:

    • Adjust pH and ionic strength

    • Test various buffer systems beyond PBS

    • Include stabilizing osmolytes (trehalose, sucrose)

  • Purification strategies:

    • Include size exclusion chromatography step to remove aggregates

    • Consider on-column refolding protocols

    • Use mild solubilization followed by gradual detergent exchange

  • Storage condition optimization:

    • Store in PBS pH 7.4 with 50% glycerol

    • Aliquot to avoid freeze-thaw cycles

    • Consider lyophilization with appropriate excipients

For small volumes of AQP5 that become entrapped in the container cap during storage, brief centrifugation of the vial is recommended to recover the protein .

How can recombinant pig AQP5 be effectively used in structural biology studies?

Recombinant pig AQP5 can be valuable for structural biology investigations through several approaches:

  • X-ray crystallography:

    • Requires production of highly pure, homogeneous protein

    • Detergent screening for optimal crystal formation

    • Lipidic cubic phase (LCP) crystallization as an alternative approach

    • Potential for structure determination at <3Å resolution

  • Cryo-electron microscopy (cryo-EM):

    • Suitable for membrane proteins without crystallization

    • Detergent micelles or nanodiscs for protein stabilization

    • Potential for visualization of dynamic states

    • Increasing resolution capabilities approaching atomic detail

  • Nuclear magnetic resonance (NMR):

    • Isotopic labeling (15N, 13C) during recombinant expression

    • Solution NMR for dynamic regions (termini, loops)

    • Solid-state NMR for transmembrane domains

  • Molecular dynamics simulations:

    • Using experimental structures as starting models

    • Simulating water transport mechanisms

    • Investigating conformational changes

    • Computational screening of potential modulators

Studies have achieved extensive sequence coverage (>56%) of human AQP5 using tandem mass spectrometry of lens membrane preparations, indicating that similar approaches would be applicable to pig AQP5 .

What are the current challenges in recombinant expression of pig AQP5 and potential solutions?

Despite advances in membrane protein expression, several challenges remain for optimizing recombinant pig AQP5 production:

ChallengeDescriptionPotential Solutions
Low expression levelsInsufficient protein yield for structural studies- Increase gene dosage through multiple integrations
- Optimize codon usage
- Use stronger promoters
- Implement two-step antibiotic selection
Protein misfoldingIncorrectly folded protein lacking function- Lower expression temperature
- Co-express with chaperones
- Add specific lipids during expression
AggregationFormation of non-functional protein aggregates- Screen detergent conditions
- Optimize solubilization protocol
- Include stabilizing additives
Post-translational modificationsDifferences between recombinant and native protein- Select appropriate expression system
- Engineer modification sites
- Enzymatic treatment post-purification
Functional assessmentVerifying water channel activity- Develop robust functional assays
- Reconstitute in proteoliposomes
- Compare kinetics with native protein

Research has shown that heterologous expression of aquaporins responds strongly to increased gene dosage, with a qPCR-based method enabling fast and reliable determination of integrated plasmid copy number. This approach allows correlation of expression levels with gene dosage to identify optimal P. pastoris clones for protein production .

How do different expression tags affect the function and purification of recombinant pig AQP5?

Expression tags significantly impact both purification efficiency and potential functional characteristics of recombinant pig AQP5:

  • His-tag:

    • Most commonly used for AQP5 (N-terminal His tag)

    • Enables purification using Ni-NTA affinity chromatography

    • Generally minimal impact on protein function

    • Can be left intact or removed with specific proteases

    • Typically yields >90% purity with optimized protocols

  • GST-tag:

    • May enhance solubility

    • Allows purification under milder conditions

    • Large size may impact membrane insertion

    • Cleavable with thrombin or other proteases

  • MBP-tag:

    • Significantly enhances solubility

    • May assist proper folding

    • Large size requires removal for functional studies

    • Potential for higher expression levels

  • FLAG or Myc tags:

    • Small size minimizes functional interference

    • Enables detection with highly specific antibodies

    • Less efficient for purification than His-tags

    • Useful for co-localization studies

When using His-tagged recombinant pig AQP5, the protein is typically stored in PBS pH 7.4 containing 50% glycerol at -20°C, with recommendations to avoid repeated freeze/thaw cycles .

What insights can comparative studies between recombinant pig AQP5 and other species provide?

Comparative studies between pig AQP5 and its homologs from other species offer valuable scientific insights:

  • Evolutionary conservation:

    • AQP5 protein expression has been confirmed in mouse, rat, bovine, and human tissues

    • Western blotting demonstrates similar molecular weights across species

    • Sequence alignment reveals conserved functional domains

  • Species-specific processing:

    • Evidence suggests AQP5 undergoes C-terminal truncation in the lens core

    • Differentiation-dependent changes in subcellular location observed

    • These processes appear conserved across species, suggesting functional importance

  • Functional specialization:

    • Comparative water permeability assays can reveal species-specific transport kinetics

    • Differential regulation mechanisms may exist

    • Species-specific interactions with regulatory proteins

  • Structural variation:

    • Minor sequence variations may influence channel selectivity

    • Species-specific post-translational modifications

    • Differential responses to regulatory stimuli

Immunohistochemistry studies have shown that AQP5 signal distribution follows specific patterns that are conserved across species, being most abundant in the outer cortex of the lens and decreasing in intensity in the lens core .

What are the most common issues when working with recombinant pig AQP5 and how can they be resolved?

Researchers commonly encounter several challenges when working with recombinant pig AQP5. Here are the most frequent issues and their solutions:

IssuePossible CausesSolutions
Low expression yield- Inadequate gene dosage
- Poor transcription/translation
- Protein toxicity
- Screen for clones with multiple gene copies
- Optimize codon usage
- Use inducible expression systems
- Reduce expression temperature
Protein degradation- Protease activity
- Instability in buffer
- Include protease inhibitors
- Optimize buffer composition
- Maintain cold temperatures during purification
- Add stabilizing agents (glycerol, specific lipids)
Poor solubilization- Inadequate detergent
- Improper detergent:protein ratio
- Screen multiple detergents
- Optimize detergent concentration
- Test mixed micelle systems
- Consider nanodiscs or amphipols
Failed antibody detection- Epitope inaccessibility
- Low cross-reactivity
- Denaturation issues
- Try multiple antibodies targeting different epitopes
- Optimize antigen retrieval for IHC
- Test different blocking agents
- Adjust antibody dilutions (WB: 1:500-1:2000; IHC: 1:2500-1:10000)
Activity loss- Denaturation during purification
- Critical lipid loss
- Detergent interference
- Gentler purification conditions
- Add back specific lipids
- Reconstitute in proteoliposomes
- Avoid harsh detergents

Small volumes of recombinant AQP5 may become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap .

How can I differentiate between genuine AQP5 expression and artifacts in my detection systems?

Distinguishing between authentic AQP5 signal and artifacts requires multiple validation approaches:

  • Positive and negative controls:

    • Positive control: Tissues known to express AQP5 (lung, salivary gland)

    • Negative control: Tissues without AQP5 expression

    • siRNA/shRNA knockdown to confirm specificity

    • Blocking peptide competition to verify antibody specificity

  • Multiple detection methods:

    • Combine Western blotting, immunohistochemistry, and mass spectrometry

    • Verify protein size (27-28 kDa) by Western blotting

    • Confirm subcellular localization by immunofluorescence

    • Validate protein identity by mass spectrometry sequence coverage

  • Cross-validation approaches:

    • Use multiple antibodies targeting different epitopes

    • Combine tag detection (anti-His) with protein detection (anti-AQP5)

    • Express fluorescent protein fusions to confirm localization

    • Functional assays to confirm water channel activity

  • Artifact identification:

    • Non-specific antibody binding appears at unexpected molecular weights

    • Poor reproducibility between experiments suggests artifacts

    • Signal in negative control samples indicates false positives

    • Unusual subcellular localization patterns may indicate artifacts

Tandem mass spectrometry has achieved extensive sequence coverage (56.2%) for human AQP5, providing a gold standard for protein identification that can be applied to pig AQP5 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.