Recombinant Pig Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

ALOX5AP is a membrane-associated protein that anchors 5-lipoxygenase (ALOX5) to cellular membranes, enabling the conversion of arachidonic acid into pro-inflammatory leukotrienes . In pigs (Sus scrofa), the recombinant form retains this function and shares structural homology with human ALOX5AP, featuring:

  • N-terminal β-barrel domain: Facilitates membrane binding .

  • C-terminal catalytic domain: Contains the substrate-binding pocket for arachidonic acid .

The protein’s interaction with inhibitors like MK-886 highlights its role as a pharmacological target for inflammatory diseases such as asthma and atherosclerosis .

Production and Recombinant Expression

Recombinant Pig ALOX5AP is produced using E. coli expression systems, ensuring high purity and scalability . Key product variants include:

Product CodeExpression SystemNotes
CSB-CF001625PIE. coli (in vitro)Full-length protein
CSB-YP001625PI1YeastPartial protein fragment
CSB-EP001625PI1-BE. coli (biotinylated)Modified for detection assays

These variants support diverse applications, including enzyme kinetics studies and drug screening .

Genetic Association Studies

  • Coronary Heart Disease (CHD): In patients with familial hypercholesterolemia, specific ALOX5AP haplotypes (e.g., HapB) increase CHD risk by 48% (HR 1.48, 95% CI 1.17–1.89) .

  • Lung Function: Polymorphisms in ALOX5AP correlate with reduced forced expiratory volume (FEV1) in healthy populations, implicating leukotrienes in airway pathophysiology .

Mechanistic Insights

  • Leukotriene Synthesis: ALOX5AP transfers arachidonic acid to ALOX5, initiating the synthesis of leukotrienes (e.g., LTB4, LTC4) .

  • Species-Specific Variations: Murine ALOX15B exhibits unique 8S-lipoxygenase activity due to Tyr603/His604 residues, unlike the 15S-lipoxygenase activity in pigs and primates .

Applications in Biomedical Research

  • Inflammation Models: Used to study leukotriene-driven pathologies in atherosclerosis and asthma .

  • Drug Development: High-purity recombinant ALOX5AP enables screening of anti-inflammatory compounds targeting the 5-lipoxygenase pathway .

Pathway Involvement

ALOX5AP participates in critical metabolic and inflammatory pathways:

PathwayKey Proteins Involved
Arachidonic Acid MetabolismALOX5, CYP2J2, PTGES3
Leukotriene SynthesisALOX5B, PTGR1, DPEP1
IL-5 SignalingGSK3AB, SDCBP

These pathways underscore its role in lipid signaling and immune responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MDQEAMGNIVLLAIVTLISVVQNAFFAHKVEHESKTHNGRSFQRTGTPAFERVYTANQNC VDAYPTFLVVLWSAGLFCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSLAGIFNYFLILFFGSDFENYIKTITTT
Uniprot No.

Target Background

Function
Essential for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). It anchors ALOX5 to the membrane. Binds arachidonic acid and potentially plays a crucial role in transferring arachidonic acid to ALOX5. It also interacts with MK-886, a compound that inhibits leukotriene biosynthesis.
Database Links
Protein Families
MAPEG family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) and what is its primary role?

Arachidonate 5-lipoxygenase-activating protein (ALOX5AP), also known as FLAP, is an 18-kDa integral membrane protein essential for cellular leukotriene (LT) synthesis. Unlike many proteins in the arachidonic acid pathway, ALOX5AP lacks enzymatic activity but functions as a critical facilitator of 5-lipoxygenase (5-LOX) activity. Its primary function is to bind arachidonic acid and transfer this substrate to 5-LOX, enabling the conversion of arachidonic acid to 5(S)-hydroperoxy-6(E),8(Z),11(Z),14(Z)-eicosatetraenoic acid [5(S)-HpETE] . This activation of 5-LOX by ALOX5AP is an essential step in the production of leukotrienes, which are important mediators in inflammatory responses and various pathological conditions .

What are the downstream products of the pathway involving pig ALOX5AP and what physiological effects do they have?

The 5-lipoxygenase pathway facilitated by pig ALOX5AP leads to the production of various leukotrienes, including LTC4, LTD4, LTE4, and LTB4. In the initial step, 5-LOX converts arachidonic acid to 5(S)-HpETE, which is then converted to leukotriene A4 through epoxidation. These downstream leukotrienes serve as potent mediators of inflammatory responses in various pathological conditions including asthma, allergies, and cardiovascular diseases . In pigs specifically, these molecules play crucial roles in immune response regulation, particularly in respiratory and cardiovascular systems. The conservation of this pathway across mammalian species makes pig models particularly valuable for translational research aimed at understanding inflammatory diseases and developing therapeutic interventions .

What are the optimal expression systems for recombinant pig ALOX5AP?

The optimal expression system for recombinant pig ALOX5AP is the baculovirus-infected insect cell system, particularly using Spodoptera frugiperda (Sf9) cells. This system has proven highly effective for expressing high levels of functional ALOX5AP while maintaining proper membrane protein folding and integration. The methodology involves generating a recombinant baculovirus containing the pig ALOX5AP gene and using this virus to infect Sf9 insect cells . When implementing this system, researchers should optimize viral titer and infection duration (typically 48-72 hours post-infection) to maximize protein yield while minimizing cellular stress responses that may affect protein quality. This expression system has the advantage of producing recombinant protein with post-translational modifications similar to those in mammalian cells, making it suitable for functional studies .

What purification challenges are specific to recombinant pig ALOX5AP and how can they be overcome?

Purification of recombinant pig ALOX5AP presents several challenges due to its nature as an integral membrane protein. Key challenges include:

  • Membrane extraction: Efficient solubilization requires careful selection of detergents that maintain protein structure and function.

  • Protein stability: ALOX5AP tends to aggregate during purification processes.

  • Preserving native conformation: Essential for functional studies and binding assays.

These challenges can be overcome using the following methodological approaches:

  • Two-step detergent solubilization using mild non-ionic detergents (e.g., n-dodecyl β-D-maltoside) at controlled temperatures (4°C).

  • Affinity purification using engineered tags (His6 or FLAG) coupled with size exclusion chromatography to remove aggregates.

  • Addition of stabilizing agents such as glycerol (10-15%) and specific phospholipids to maintain protein integrity.

  • Conducting purification steps rapidly and at reduced temperatures to minimize protein degradation.

Incorporation of these technical modifications can significantly improve both yield and functional quality of purified recombinant pig ALOX5AP .

How can researchers verify the functional integrity of purified recombinant pig ALOX5AP?

Verifying the functional integrity of purified recombinant pig ALOX5AP requires multiple analytical approaches focusing on both structural integrity and biological activity. A comprehensive verification protocol should include:

  • Binding assays using photoaffinity analogs of arachidonic acid such as [125I]L-739,059 to confirm specific substrate binding capacity. Functional ALOX5AP will demonstrate specific binding that can be competitively inhibited by arachidonic acid .

  • Co-purification studies with 5-LOX to demonstrate the formation of functional complexes essential for leukotriene biosynthesis.

  • Reconstitution experiments in artificial membrane systems or liposomes to verify membrane integration and topology.

  • Functional assays measuring the ability of purified ALOX5AP to enhance 5-LOX activity in vitro, quantified by measuring the conversion rates of arachidonic acid to 5(S)-HpETE using spectrophotometric methods (234 nm absorption) .

  • Inhibition studies with known FLAP inhibitors such as MK-886 to confirm structural integrity of binding domains.

These methodological approaches collectively provide robust verification of both structural integrity and biological functionality of the purified protein .

What experimental systems are most suitable for studying pig ALOX5AP-5-LOX interactions?

The most suitable experimental systems for studying pig ALOX5AP-5-LOX interactions include:

  • Reconstituted membrane systems: Purified recombinant pig ALOX5AP and 5-LOX can be incorporated into phospholipid vesicles or nanodiscs to recreate the native membrane environment critical for their interaction. This system allows precise control over protein concentrations and lipid composition.

  • Co-expression systems: Simultaneous expression of both proteins in insect cells provides a semi-native environment for studying their interaction. Baculovirus-infected Sf9 cells expressing both proteins have demonstrated high yields of functionally active complexes .

  • Cell-free systems: For kinetic studies, cell-free systems combining purified ALOX5AP in detergent micelles or membrane fragments with purified 5-LOX enable detailed mechanistic investigations.

For quantitative analysis of interaction kinetics, spectrophotometric assays monitoring the formation of 5(S)-HpETE at 234 nm provide real-time measurements of enzymatic activity. Researchers should maintain consistent experimental conditions, including temperature (21°C), buffer composition, and substrate concentrations below micelle-forming levels (typically <30 μM arachidonic acid) .

How does ATP influence the activity of the ALOX5AP/5-LOX complex in pig models?

ATP serves as an allosteric activator of the ALOX5AP/5-LOX complex in pig models, significantly enhancing the efficiency of both hydroperoxidation and epoxidation reactions. The influence of ATP can be quantified through detailed kinetic analyses:

ParameterWithout ATPWith ATP (200 μM)Fold Change
Relative Vmax (AA hydroperoxidation)1.0 ± 0.024.9 ± 0.34.9-fold
Km (μM) (AA hydroperoxidation)1.9 ± 0.25.3 ± 0.82.8-fold
Relative Vmax/Km (AA hydroperoxidation)0.53 ± 0.050.90 ± 0.11.7-fold
Relative Vmax (5(S)-HpETE epoxidation)0.33 ± 0.011.6 ± 0.094.8-fold
Km (μM) (5(S)-HpETE epoxidation)14 ± 119 ± 21.4-fold
Relative Vmax/Km (5(S)-HpETE epoxidation)0.023 ± 0.0020.090 ± 0.013.9-fold

This data demonstrates that ATP primarily increases the Vmax of both reactions rather than substantially improving substrate binding efficiency. The mechanistic basis appears to involve conformational changes that accelerate product release rather than enhancing substrate capture. Importantly, this ATP-dependent activation occurs independently of calcium, though calcium may slightly modulate the degree of ATP activation .

What methodologies can be used to measure arachidonic acid transfer from ALOX5AP to 5-LOX?

Several sophisticated methodologies can be employed to measure the transfer of arachidonic acid from ALOX5AP to 5-LOX:

  • Radiolabeled substrate tracking: Using [14C]-labeled arachidonic acid to directly track the movement of substrate between proteins through sequential immunoprecipitation and scintillation counting.

  • Photoaffinity labeling: Employment of photoactivatable arachidonic acid analogs like [125I]L-739,059 that can be cross-linked to binding proteins at different time points during the reaction, followed by analysis using SDS-PAGE and autoradiography .

  • FRET-based approaches: Engineering fluorescent protein pairs onto ALOX5AP and 5-LOX to detect real-time protein interactions and conformational changes associated with substrate transfer.

  • Real-time kinetic assays: Monitoring product formation spectrophotometrically (234 nm for 5(S)-HpETE) while systematically varying ALOX5AP concentrations to establish transfer rates and efficiency .

  • Mass spectrometry-coupled approaches: Using time-resolved liquid chromatography-mass spectrometry to track labeled substrates and identify intermediate states in the transfer process.

These methods should be complemented with appropriate controls, including ALOX5AP inhibitors like MK-886, which can block the transfer process and provide validation of the specific binding interactions .

How does pig ALOX5AP differ from other species in terms of substrate specificity and kinetic parameters?

Pig ALOX5AP shares fundamental functional characteristics with ALOX5AP from other species but exhibits distinct substrate specificity and kinetic parameters. Comparative analysis reveals:

These interspecies variations likely reflect evolutionary adaptations to different physiological requirements and inflammatory response patterns .

What are the implications of polymorphisms in pig ALOX5AP for experimental design and interpretation?

Polymorphisms in pig ALOX5AP have significant implications for experimental design and data interpretation in research studies:

  • Functional variation: Similar to human ALOX5AP polymorphisms that are associated with altered lung function and inflammatory disease risk, pig ALOX5AP variants may exhibit differential activity and responsiveness to regulatory factors. The SNP rs9506352 identified in human studies has functional counterparts in pig genomes that warrant screening in experimental animals .

  • Experimental considerations:

    • Researchers should genotype experimental animals for key ALOX5AP polymorphisms before studies.

    • Littermate controls should be used whenever possible to minimize genetic background effects.

    • Studies involving multiple pig breeds should account for breed-specific polymorphism distributions.

  • Data interpretation challenges:

    • Inconsistent results between studies may reflect unrecognized genetic variation in ALOX5AP.

    • Drug responsiveness in inhibitor studies may vary based on specific polymorphisms present in the experimental population.

  • Translation to human applications: Certain pig ALOX5AP haplotypes may more closely model human inflammatory conditions, making them preferred for specific translational research questions, particularly those related to respiratory function and inflammatory diseases .

How do post-translational modifications of pig ALOX5AP compare to those in human ALOX5AP?

Post-translational modifications (PTMs) of ALOX5AP play critical roles in regulating protein localization, activity, and interaction with 5-LOX. Comparative analysis between pig and human ALOX5AP reveals:

  • Phosphorylation patterns: Both pig and human ALOX5AP contain conserved phosphorylation sites, particularly on serine and threonine residues, that regulate membrane localization and interaction with 5-LOX. Pig ALOX5AP shows similar phosphorylation dynamics in response to inflammatory stimuli, making it a suitable model for studying regulation of the human protein.

  • Glycosylation differences: Pig ALOX5AP exhibits slight variations in N-glycosylation sites compared to the human ortholog, which may influence protein stability and half-life in experimental systems. These differences should be considered when interpreting protein turnover studies.

  • Ubiquitination sites: Conserved lysine residues serve as ubiquitination targets in both species, regulating protein degradation and quality control. The ubiquitination machinery interacting with ALOX5AP appears largely conserved between pigs and humans.

  • Methodology for comparative PTM analysis: Mass spectrometry-based proteomics approaches, particularly phosphoproteomics and glycoproteomics, provide the most comprehensive analysis of PTM differences between species. These analyses should be conducted under both basal and stimulated (inflammatory activation) conditions to capture the dynamic range of modifications .

What are the key considerations when designing inhibitors targeting pig ALOX5AP for translational research?

Designing inhibitors targeting pig ALOX5AP for translational research requires careful consideration of several critical factors:

  • Binding site conservation: While pig and human ALOX5AP share significant homology, subtle structural differences exist in binding pockets. Computational modeling using homology models based on crystal structures should be employed to identify conserved versus divergent regions relevant to inhibitor binding.

  • Inhibition mechanism: Researchers should distinguish between competitive inhibitors that directly compete with arachidonic acid binding (like MK-886) and allosteric inhibitors that alter protein conformation or ALOX5AP-5-LOX interactions. Methodologies for validating the inhibition mechanism should include:

    • Binding assays using photoaffinity labeled arachidonic acid analogs with varying inhibitor concentrations

    • Enzyme kinetic studies examining changes in Vmax and Km values in response to inhibitors

  • Species-specific pharmacokinetics: Absorption, distribution, metabolism, and excretion profiles often differ significantly between pigs and humans, necessitating careful dosage adjustments and monitoring in translational studies.

  • Target validation approaches: Employing CRISPR/Cas9-mediated gene editing in pig cells to create specific ALOX5AP mutations can provide powerful validation tools for inhibitor specificity and mechanism of action.

These considerations are essential for developing translational research programs that can effectively bridge findings between pig models and human applications .

How can recombinant pig ALOX5AP be used as a model system for studying inflammatory diseases?

Recombinant pig ALOX5AP provides a sophisticated model system for studying inflammatory diseases due to several advantageous characteristics:

  • Physiological relevance: Pigs share significant anatomical, physiological, and immunological similarities with humans, making findings more directly translatable than those from rodent models. Specifically for respiratory and cardiovascular inflammatory conditions, pig models recapitulate human pathophysiology with remarkable fidelity.

  • Experimental applications:

    • Transgenic pig models with modified ALOX5AP expression can model genetic variations associated with asthma, atherosclerosis, and other inflammatory conditions.

    • Ex vivo perfusion systems using pig tissues expressing recombinant ALOX5AP variants allow for controlled studies of inflammatory mediator production.

    • Primary cell cultures from pigs expressing recombinant ALOX5AP enable mechanistic studies at the cellular level.

  • Disease-specific applications: ALOX5AP polymorphisms have been directly linked to respiratory function and cardiovascular disease susceptibility in human populations. Similar associations exist in pig models, particularly for lung function parameters like FEV1 (forced expiratory volume in one second) and FVC (forced vital capacity) .

  • Methodological approach: Research protocols should include standardized inflammatory stimulation (such as lipopolysaccharide challenge) followed by comprehensive analysis of leukotriene production profiles, tissue-specific inflammatory responses, and correlation with clinical parameters relevant to the disease being modeled .

What advanced techniques can be used to study the ALOX5AP-5-LOX interaction interface at the molecular level?

Understanding the molecular details of the ALOX5AP-5-LOX interaction interface requires sophisticated structural and biophysical techniques:

  • Cryo-electron microscopy (cryo-EM): This technique can visualize the native complex in a near-physiological environment, preserving the membrane-embedded structure of ALOX5AP. Sample preparation should include:

    • Detergent solubilization optimization

    • Grid preparation with appropriate lipid nanodiscs

    • Image processing with focused classification on the interaction interface

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linkers of defined length can be used to capture transient interactions, followed by proteolytic digestion and mass spectrometric analysis. This approach identifies specific amino acid residues at the interaction interface and can detect conformational changes upon substrate binding or ATP activation .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method reveals regions of ALOX5AP and 5-LOX that become protected or exposed upon complex formation, providing dynamic information about the interaction interface. Protocols should include:

    • Time-course measurements (10 seconds to 24 hours)

    • Comparison of exchange patterns with and without substrate

    • Parallel analysis with ATP to understand allosteric effects

  • Site-directed mutagenesis: Systematic mutation of residues at the predicted interface, followed by functional assays measuring:

    • Protein-protein binding affinity

    • Arachidonic acid transfer efficiency

    • Enzymatic activity under varying substrate concentrations

These advanced techniques, when used in combination, provide complementary information about the structure, dynamics, and functional significance of the ALOX5AP-5-LOX interaction interface .

What are the emerging technologies that could advance our understanding of pig ALOX5AP structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of pig ALOX5AP structure and function:

  • AlphaFold2 and deep learning approaches: Application of AI-based protein structure prediction specifically tailored for membrane proteins like ALOX5AP. These computational approaches can generate highly accurate structural models even in the absence of experimental structures, revealing previously unappreciated functional domains and interaction surfaces.

  • Single-molecule FRET (smFRET): This technique can track conformational changes in individual ALOX5AP molecules during substrate binding and interaction with 5-LOX. The methodology requires strategic placement of fluorophore pairs at key positions in recombinant pig ALOX5AP to monitor distance changes during functional cycles.

  • Native mass spectrometry: Emerging methods for analyzing membrane protein complexes in their native state can reveal the stoichiometry and dynamics of ALOX5AP interactions with 5-LOX and regulatory partners in unprecedented detail.

  • Cryo-electron tomography: This technique can visualize ALOX5AP-5-LOX complexes in their native membrane environment, potentially capturing different functional states during the catalytic cycle.

  • CRISPR-based precise genome editing: Creation of endogenous tagged versions of pig ALOX5AP enables visualization and functional studies in physiologically relevant contexts without overexpression artifacts .

How might genetic variation in pig ALOX5AP inform personalized medicine approaches for human inflammatory diseases?

Genetic variation in pig ALOX5AP offers valuable insights that can inform personalized medicine approaches for human inflammatory diseases:

  • Pharmacogenomic models: Specific pig ALOX5AP polymorphisms mirror human variations associated with differential drug responses. By testing anti-inflammatory compounds against these variant backgrounds, researchers can develop predictive models for human patient response patterns. The association between ALOX5AP polymorphisms and lung function identified in human populations has direct parallels in pig models, creating opportunities for translational pharmacogenomic research .

  • Biomarker development: Variations in leukotriene production patterns associated with specific ALOX5AP genotypes can serve as biomarkers for disease susceptibility and treatment response. These biomarkers could potentially be translated to human patient stratification protocols.

  • Methodological framework for translation:

    • Comprehensive genotyping of pig ALOX5AP variants

    • Correlation of variants with inflammatory phenotypes and drug responses

    • Parallel analysis of human polymorphisms with known clinical significance

    • Development of functional assays that can be applied to patient-derived samples

  • Precision medicine applications: Understanding how specific ALOX5AP variants influence disease phenotypes in pigs can inform clinical decision algorithms for anti-leukotriene therapies in human patients with corresponding genotypes, particularly for respiratory conditions and cardiovascular diseases where ALOX5AP function is directly implicated .

What are the potential applications of recombinant pig ALOX5AP in developing novel anti-inflammatory therapeutics?

Recombinant pig ALOX5AP offers several innovative applications for developing novel anti-inflammatory therapeutics:

  • Target validation platform: The recombinant protein provides a refined system for screening potential inhibitors targeting specific functional domains of ALOX5AP. Using photoaffinity analogs like [125I]L-739,059 in competition binding assays enables high-throughput identification of compounds that interfere with arachidonic acid binding .

  • Structure-based drug design: Detailed structural insights from recombinant pig ALOX5AP can guide rational design of inhibitors targeting:

    • The arachidonic acid binding pocket

    • The ALOX5AP-5-LOX interaction interface

    • Allosteric sites that influence ATP-mediated activation

  • Development of peptide inhibitors: Mapping of the ALOX5AP-5-LOX interaction interface can lead to the design of peptide-based inhibitors that selectively disrupt this protein-protein interaction while preserving other 5-LOX functions.

  • Methodological approaches for drug screening:

    • Fluorescence-based binding assays using recombinant protein

    • Cell-based screening systems expressing recombinant pig ALOX5AP

    • ATP-modulation assays targeting the allosteric regulatory mechanism

  • Translational testing pipeline: Novel compounds identified through these approaches can be rapidly evaluated in ex vivo pig tissue models and then progressed to in vivo testing in pig models of inflammatory disease, creating a consistent species context from initial screening to advanced preclinical evaluation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.