Recombinant Pig ATP-binding cassette sub-family G member 2 (ABCG2)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Pig ATP-binding cassette sub-family G member 2 (ABCG2) is a 656-amino-acid transmembrane protein (UniProt ID: Q8MIB3) produced in Escherichia coli with an N-terminal polyhistidine (His) tag . This full-length protein belongs to the ATP-binding cassette (ABC) transporter superfamily, known for its role in cellular efflux of xenobiotics, endogenous metabolites, and drugs .

Notable Functional Data

  • Urate transport capacity reduced by 53% in the Q141K polymorphic variant (rs2231142), a major risk factor for hyperuricemia and gout .

  • ATPase activity assays confirm preserved catalytic function in recombinant variants (e.g., M71V), though expression levels are reduced .

Role in Disease Pathology

ConditionABCG2 Involvement
GoutImpaired urate secretion due to mutations (e.g., Q141K) elevates serum urate .
Drug ResistanceOverexpression in cancer cells confers resistance to topoisomerase inhibitors .
Porphyrin HomeostasisMediates export of protoporphyrin IX, preventing cytotoxicity .

In Vitro and Preclinical Studies

Recombinant Pig ABCG2 is utilized to:

  • Characterize transporter kinetics using Xenopus oocytes or membrane vesicles .

  • Study structure-function relationships via mutagenesis (e.g., Q141K, M71V) .

  • Screen modulators (e.g., fumitremorgin C) to reverse multidrug resistance .

Diagnostic and Therapeutic Tools

  • ELISA Kits: Detect endogenous ABCG2 in pig tissues (e.g., liver, kidney) with sandwich assays .

  • Antibodies: Polyclonal antibodies (e.g., GTX100437) enable Western blot and IHC detection .

Expression and Purification

  • Yield: ~0.1–1.0 mg/mL post-reconstitution .

  • Stability: Glycerol (5–50%) enhances long-term storage at -80°C .

Comparative Analysis Across Species

SpeciesKey Differences
Human72% sequence identity; stronger link to clinical drug resistance .
Mouse97% identity; used in knockout models for pharmacokinetic studies .
Chicken56% identity; folate homeostasis studies highlight epigenetic regulation .

Genetic Variants and Population Impact

  • Q141K (rs2231142):

    • Frequency: MAF = 0.11 (whites), 0.03 (blacks) .

    • Effect: 1.68x higher gout risk per allele .

  • M71V: Reduces membrane expression but retains partial activity .

Therapeutic Targeting

  • 4-Phenylbutyrate (4-PBA): Corrects trafficking defects in ABCG2 mutants .

  • Colchicine: Upregulates wild-type ABCG2 expression, potentially enhancing urate secretion .

Future Directions

  • Resolve high-resolution structures via cryo-EM to guide inhibitor design.

  • Develop in vivo models to assess ABCG2’s role in dietary toxin protection .

  • Explore epigenetic regulation (e.g., DNA methylation) in tissue-specific expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. Please inform us of your required tag type for preferential development.
Synonyms
ABCG2; BMDP; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Brain multidrug resistance protein; Urate exporter; CD antigen CD338
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-656
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MSSNSYQVSIPMSKRNTNGLPGSSSNELKTSAGGAVLSFHDICYRVKVKSGFLFCRKTVE KEILTNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPHGLSGDVLINGAPRPANFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLPTTMTNHEKNERINMVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIAMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDSLTLLASGRLMFHGPAREALGYFASIGYNCEPYNNPADFFLDVING DSSAVVLSRADRDEGAQEPEEPPEKDTPLIDKLAAFYTNSSFFKDTKVELDQFSGGRKKK KSSVYKEVTYTTSFCHQLRWISRRSFKNLLGNPQASVAQIIVTIILGLVIGAIFYDLKND PSGIQNRAGVLFFLTTNQCFSSVSAVELLVVEKKLFIHEYISGYYRVSSYFFGKLLSDLL PMRMLPSIIFTCITYFLLGLKPAVGSFFIMMFTLMMVAYSASSMALAIAAGQSVVSVATL LMTISFVFMMIFSGLLVNLKTVVPWLSWLQYFSIPRYGFSALQYNEFLGQNFCPGLNVTT NNTCSFAICTGAEYLENQGISLSAWGLWQNHVALACMMVIFLTIAYLKLLLLKKYS
Uniprot No.

Target Background

Function
ABCG2 is an ATP-binding cassette (ABC) transporter with broad substrate specificity. It actively extrudes a wide range of compounds, including physiological substances, dietary toxins, and xenobiotics, from cells. Its functions include: porphyrin homeostasis (exporting protoporphyrin IX from mitochondria to cytosol and cytosol to extracellular space, and heme export); sphingosine-1-P efflux; urate excretion (renal and extrarenal); excretion of uremic toxins (e.g., indoxyl sulfate); steroid excretion (e.g., estrone 3-sulfate, DHEAS, and other sulfate conjugates); secretion of riboflavin and biotin into milk; pheophorbide a efflux; xenobiotic exclusion from the brain; multidrug resistance (e.g., mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, daunorubicin, doxorubicin); limiting drug penetration from maternal plasma to the fetus (placenta); and potential involvement in early stem cell self-renewal by inhibiting differentiation.
Gene References Into Functions
  1. High ABCG2 expression in endocardial endothelial cells protects against apoptosis in the presence of anticancer agents. PMID: 26661076
Database Links

KEGG: ssc:397073

STRING: 9823.ENSSSCP00000028560

UniGene: Ssc.64

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
High expression in brain, kidney and lung. Also expressed in livere, colon, small intestine, heart, skeletal muscle, spleen, stomach and pancreas.

Q&A

What is the molecular structure and characterization of pig ABCG2?

Pig ABCG2 (also known as breast cancer resistance protein, brain multidrug resistance protein, urate exporter, or CD338) is an ATP-binding cassette transporter with UniProt accession number Q8MIB3 and gene ID 397073 . Like other ABCG family members, pig ABCG2 consists of a single ABC cassette in the amino terminal region followed by transmembrane domains .

The typical ABCG2 structure requires dimerization to become functionally active. ABCG family members form either homodimers or obligate heterodimers for proper function, creating a complete transporter capable of ATP-dependent substrate transport across cellular membranes . The pig ABCG2 protein shares significant structural homology with ABCG2 proteins from other species, particularly within conserved functional domains including the nucleotide-binding domain and transmembrane regions.

Comparative analysis with chicken ABCG2, which was extensively characterized in one study, reveals that ABCG2 proteins typically contain multiple transmembrane regions. The chicken ABCG2 contains five transmembrane domains and has a theoretical molecular mass of approximately 77.4 kDa . We can expect pig ABCG2 to have similar structural characteristics, though species-specific variations likely exist in certain domains.

How does pig ABCG2 expression differ across tissues?

While pig-specific tissue distribution data is limited in the provided search results, insights can be drawn from studies in other species. In broiler chickens, ABCG2 shows differential expression across tissues, with the highest expression levels detected in the liver and the lowest in the spleen . This tissue-specific expression pattern suggests specialized functions in different organ systems.

The liver's high expression of ABCG2 is consistent with its role in xenobiotic metabolism and transport, as the liver serves as a primary detoxification organ . This finding aligns with the established role of ABCG2 in drug metabolism and transport across multiple species. The relatively low expression in immune tissues like the spleen may indicate a lesser role in immune function compared to detoxification processes.

In mammals, ABCG2 is typically expressed in barriers and excretory organs, including the blood-brain barrier, placenta, liver, intestines, and kidney, where it contributes to protection against xenobiotics and pharmacokinetic processes . Researchers working with pig ABCG2 should anticipate similar expression patterns, though species-specific variations should be experimentally confirmed.

What are the main physiological functions of ABCG2 in pigs?

Based on conserved functions across species, pig ABCG2 likely plays several critical physiological roles:

  • Xenobiotic transport: Unlike other ABCG family members that primarily transport cholesterol, ABCG2 exhibits broad substrate specificity for xenobiotic compounds . It functions as an efflux transporter that can export various compounds, including toxins and drugs, from cells.

  • Drug resistance: ABCG2 confers resistance to anticancer drugs and plays a critical role in the pharmacokinetics of drugs in clearance organs and tissue barriers . In cancer research contexts, its overexpression correlates with multidrug resistance.

  • Cellular protection: ABCG2 likely protects cells and tissues from potentially harmful exogenous and endogenous compounds by actively exporting them from cells.

  • Metabolic regulation: Recent research indicates ABCG2 may interact with other membrane proteins such as SLC1A5 (a glutamine transporter) to influence metabolic pathways in cells .

Unlike other ABCG family members (ABCG1, ABCG4, ABCG5, and ABCG8) that are primarily involved in cholesterol efflux, ABCG2 has evolved to handle a broader range of substrates, making it particularly important in pharmaceutical research and toxicology studies .

How does methylation affect ABCG2 expression patterns?

DNA methylation represents an important epigenetic mechanism that regulates ABCG2 expression. Studies in broiler chickens have investigated the relationship between ABCG2 methylation and expression under different dietary conditions. When examining CpG sites in exon 2 of the chicken ABCG2 gene, researchers found that folate deficiency led to decreased methylation percentages (from 91.3% in normal folate groups to 87.5% in folate-deficient groups), though this decrease was not statistically significant .

For pig ABCG2 research, this suggests that epigenetic regulation through DNA methylation likely plays a role in controlling expression levels. Published literature has established the significance of this mechanism in human ABCG2 expression:

"Previous study reported that DNA methylation-dependent formation of a repressor complex in the GpG islands contributes to inactivation of ABCG2 in renal cell carcinoma cell lines. Similar findings were reported in human multiple myeloma cell lines by Turner et al, who found that a decrease in promoter methylation led to an increase in ABCG2 expression at the mRNA and protein level" .

Researchers working with pig ABCG2 should consider examining methylation patterns in the promoter and coding regions to understand how epigenetic regulation affects expression in different physiological contexts. Techniques such as bisulfite sequencing, as used in the chicken study, would be appropriate for such investigations.

How does pig ABCG2 interact with other membrane proteins?

Recent research has revealed that ABCG2 functionally interacts with other membrane proteins, particularly transport proteins, to influence cellular functions beyond simple drug efflux. One significant interaction partner is SLC1A5, a major glutamine transporter in tumor cells .

The ABCG2-SLC1A5 interaction appears to rewire cellular metabolism and may represent a mechanism by which ABCG2 contributes to cell survival under stress conditions beyond its well-established role in drug efflux . According to recent findings: "We now report that ABCG2 interacts with SLC1A5, a member of the human solute transporter superfamily and the major glutamine transporter in tumor cells" .

For pig ABCG2 research, investigating such protein-protein interactions could reveal:

  • Species-specific interaction partners

  • Metabolic adaptations in pig cells mediated by ABCG2

  • Potential co-regulatory mechanisms between transporter systems

  • Novel functions beyond canonical drug transport

Methodologically, techniques such as co-immunoprecipitation, proximity ligation assays, and FRET (Fluorescence Resonance Energy Transfer) would be appropriate for investigating these protein-protein interactions in pig cellular systems.

What are the implications of ABCG2 in non-drug resistance survival mechanisms?

While ABCG2 has been extensively studied for its role in multidrug resistance through drug efflux, emerging evidence suggests it contributes to cell survival through additional mechanisms. Research indicates that ABCG2 overexpression correlates with survival advantages even when cells are exposed to non-substrate stressors such as nutrient deprivation and radiation .

Several studies have reported that ABCG2 overexpression is accompanied by increased autophagy flux, which may confer a survival advantage under stress conditions : "Indeed, we and others have reported that ABCG2 overexpression is accompanied by an increase in autophagy flux, thereby conferring a transient but striking increase in cell survival when faced with these environmental stressors" .

For pig ABCG2 research, investigators should consider exploring:

  • The relationship between pig ABCG2 expression and autophagy markers

  • Survival advantages conferred by ABCG2 overexpression under various stress conditions

  • Metabolic adaptations mediated by pig ABCG2 beyond drug transport

  • Potential signaling pathways influenced by ABCG2 expression

Understanding these non-canonical functions of pig ABCG2 could provide insights into both physiological processes and potential therapeutic targets in both veterinary and translational medicine.

What are the optimal techniques for expressing and purifying recombinant pig ABCG2?

Recombinant expression of pig ABCG2 requires careful consideration of expression systems, purification methods, and functional validation. Based on approaches used for ABCG2 from other species, the following methodological considerations are important:

Expression Systems:

  • Mammalian cell lines (HEK293, CHO): Provide proper folding and post-translational modifications

  • Insect cell systems (Sf9, High Five): Offer high expression yields for membrane proteins

  • Yeast systems (Pichia pastoris): Economical for large-scale production

Purification Strategy:

  • Affinity tags (His-tag, FLAG-tag): Enable selective purification

  • Detergent selection: Critical for maintaining protein stability and function

  • Size exclusion chromatography: Ensures isolation of properly folded dimeric forms

A methodological workflow for recombinant pig ABCG2 production might include:

  • Cloning the pig ABCG2 coding sequence (based on Q8MIB3) into appropriate expression vectors

  • Establishing stable expression in mammalian or insect cells

  • Membrane fraction isolation and solubilization with appropriate detergents

  • Affinity purification followed by size exclusion chromatography

  • Functional validation using transport assays

For research requiring antibody detection of pig ABCG2, commercially available ELISA kits can detect natural and recombinant pig ATP-binding cassette sub-family G member 2, as mentioned in the search results .

How can researchers effectively analyze ABCG2 expression at the mRNA and protein levels?

Accurate quantification of pig ABCG2 expression requires complementary approaches targeting both mRNA and protein levels. Based on techniques described in the search results, the following methods are recommended:

mRNA Expression Analysis:

  • qPCR analysis: Real-time PCR using SYBR Green or similar detection systems with appropriate reference genes for normalization (e.g., β-actin)

  • Primer design: Specific primers targeting conserved regions of pig ABCG2

  • RNA extraction: High-quality RNA isolation from relevant tissues using stabilizing reagents

Protein Expression Analysis:

  • Western blotting: Using validated antibodies against pig ABCG2

  • ELISA: Commercial kits are available for pig ABCG2 quantification

  • Immunohistochemistry: For tissue localization studies

For qPCR analysis, the protocol used in chicken ABCG2 studies provides a useful template: "Real-time PCR (qPCR) was performed using SYBR® Premix Ex TaqTM II (TliRNaseH Plus) in optical 96-well reaction plates on a LightCycler480 real-time system. All samples were run in duplicate. PCR conditions were as followed: 95°C for 2 min, 40 cycles of 95°C for 10 s, 58 (55)°C for 10 s, 72°C for 1 s" .

Relative quantification using appropriate housekeeping genes is essential for accurate expression analysis across different tissues or experimental conditions.

What functional assays can be used to characterize pig ABCG2 transport activity?

Functional characterization of pig ABCG2 transport activity requires assays that can quantify substrate movement across membranes. Several established approaches can be adapted for pig ABCG2:

Cellular Transport Assays:

  • Accumulation assays: Measuring intracellular accumulation of fluorescent substrates (e.g., Hoechst 33342, mitoxantrone) in cells expressing pig ABCG2 versus controls

  • Transwell transport studies: Quantifying directional transport of substrates across polarized cell monolayers

  • Vesicular transport assays: Using inside-out membrane vesicles to measure ATP-dependent substrate uptake

ATPase Activity Assays:

  • Vanadate-sensitive ATPase activity: Measuring ATP hydrolysis in the presence of potential substrates

  • Beryllium fluoride-trapped nucleotide occlusion: Assessing nucleotide binding properties

Cytotoxicity-Based Functional Assays:

  • Cell viability assays (MTT, XTT): Comparing survival of pig ABCG2-expressing cells versus controls when exposed to cytotoxic ABCG2 substrates

  • Colony formation assays: Assessing long-term survival advantages conferred by pig ABCG2 expression

These functional assays should be complemented by appropriate controls, including:

  • ABCG2-specific inhibitors (e.g., Ko143, fumitremorgin C)

  • ATP-depleted conditions

  • Transport-deficient mutants

How does pig ABCG2 compare structurally and functionally to ABCG2 in other species?

Comparative analysis of ABCG2 across species provides valuable insights into conserved features and species-specific adaptations. Based on phylogenetic analysis of chicken ABCG2, we can make inferences about pig ABCG2's relationship to other species:

Studies on chicken ABCG2 revealed amino acid sequence identity ranging from 55.92% to 97.43% with other animal species . This suggests significant conservation of ABCG2 structure and function across species, despite some variations.

A phylogenetic analysis would likely place pig ABCG2 closely related to other mammalian ABCG2 proteins, particularly those from other ungulates like cattle, sheep, and goats. In studies of chicken ABCG2, researchers found "the broiler amino acid is labeled with asterisk (◆). The Genbank accession of the sequences used to build the phylogenetic tree are as follows: broiler (KU351683), human (AAG52982), mouse (NP_036050), rat (NP_852046), pig (NP_999175), sheep (NP_001072125), goat (NP_001272636), cattle (NP_001032555)" .

Functionally, pig ABCG2 likely shares the core characteristics of ABCG2 transporters from other species, including:

  • ATP-dependent transport mechanism

  • Broad substrate specificity for xenobiotics

  • Role in multidrug resistance

  • Physiological expression at barrier tissues and excretory organs

What insights can cross-species ABCG2 studies provide for understanding pig ABCG2?

Cross-species studies of ABCG2 can provide valuable insights into evolutionary adaptations, functional conservation, and species-specific characteristics. For pig ABCG2 research, comparative studies offer several advantages:

  • Identification of conserved functional domains: Sequence alignment across species can highlight invariant residues likely critical for function.

  • Species-specific substrate preferences: Comparing substrate profiles of ABCG2 from different species can reveal adaptations potentially related to dietary differences or environmental exposures.

  • Regulatory mechanisms: Cross-species analysis of promoter regions and expression patterns can identify conserved and divergent regulatory elements.

  • Structural insights: Homology modeling based on better-characterized ABCG2 structures can inform pig-specific structural features.

  • Pharmacological relevance: Understanding species differences in drug interactions with ABCG2 is crucial for translational research and veterinary medicine.

The chicken ABCG2 study demonstrated that folate deficiency significantly affected ABCG2 expression in the liver , suggesting dietary factors influence ABCG2 regulation across species. Similar nutritional studies in pigs could reveal species-specific responses and metabolic adaptations.

How can recombinant pig ABCG2 be used in drug development and toxicology studies?

Recombinant pig ABCG2 offers valuable applications in both pharmaceutical research and toxicological assessment:

Pharmaceutical Applications:

  • Drug-transporter interaction screening: Assessing whether new drug candidates are ABCG2 substrates or inhibitors

  • Species-specific pharmacokinetic predictions: Understanding species differences in drug transport relevant to veterinary medicine

  • Resistance mechanism studies: Investigating how ABCG2 contributes to treatment failure in various disease models

Toxicological Applications:

  • Xenobiotic transport assessment: Determining how environmental toxins interact with pig ABCG2

  • Food safety research: Understanding how agricultural compounds or food contaminants interact with ABCG2

  • Species-specific toxicity prediction: Identifying compounds that may have differing toxicity profiles between pigs and humans due to ABCG2 transport differences

The broad substrate specificity of ABCG2 makes it particularly relevant for these applications: "Unlike other members, ABCG2 is not involved in cholesterol efflux, but it exhibits broad substrate specificity to xenobiotic compounds" .

Research utilizing recombinant pig ABCG2 can contribute to:

  • Veterinary drug development with improved safety profiles

  • Translational research understanding species differences in drug disposition

  • Agricultural and food safety assessments

  • Comparative toxicology studies

What role does ABCG2 play in stem cell biology and how can this be studied in pig models?

ABCG2 has been associated with stem cell phenotypes across multiple species, representing an important research area for pig models. As noted in the search results: "ABCG2 is also associated with a subpopulation phenotype of stem cells" .

For researchers working with pig models, several approaches can be used to investigate ABCG2's role in stem cell biology:

  • Stem cell isolation: ABCG2 expression (often detected by side population assays) can be used to identify and isolate stem cell populations from pig tissues

  • Differentiation studies: Examining how ABCG2 expression changes during differentiation of pig stem cells into various lineages

  • Functional role assessment: Using genetic approaches (knockdown/overexpression) to determine how ABCG2 influences pig stem cell properties including:

    • Self-renewal capacity

    • Differentiation potential

    • Stress resistance

    • Metabolic characteristics

  • Comparative stem cell biology: Contrasting ABCG2's role in pig stem cells with findings from human, mouse, and other model systems

  • Translational applications: Exploring how pig stem cell models expressing ABCG2 can inform regenerative medicine approaches

The relationship between ABCG2 and stem cell phenotypes may involve:

  • Protection from xenobiotics and stress factors

  • Maintenance of specific metabolic states

  • Export of differentiating factors or signaling molecules

  • Interaction with fundamental stem cell signaling pathways

What are the emerging areas of ABCG2 research relevant to pig models?

Several emerging research directions present opportunities for advancing our understanding of pig ABCG2:

  • Metabolic interactions: Recent research has revealed that "ABCG2 and SLC1A5 functionally interact to rewire metabolism" , suggesting pig ABCG2 may play roles in metabolic regulation beyond xenobiotic transport.

  • Non-canonical functions: Evidence indicates that ABCG2 contributes to cell survival through mechanisms independent of drug efflux, including modulation of autophagy . These alternative functions merit investigation in pig models.

  • Tissue-specific regulation: Understanding how pig ABCG2 expression is regulated in different tissues could reveal novel physiological roles and regulatory mechanisms.

  • Genetic polymorphisms: Identifying natural variations in pig ABCG2 and their functional consequences could provide insights into individual variations in drug responses and disease susceptibility.

  • Epigenetic regulation: Building on findings that methylation affects ABCG2 expression , comprehensive epigenetic studies in pig models could reveal additional regulatory mechanisms.

  • Protein-protein interaction networks: Expanding on the ABCG2-SLC1A5 interaction , mapping the complete interactome of pig ABCG2 could reveal novel functional associations.

These research directions offer promising avenues for advancing both basic science understanding of ABCG2 function and translational applications in drug development and disease modeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.