Recombinant Pig ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig ATP Synthase Subunit a (MT-ATP6)

Recombinant Pig ATP Synthase Subunit a (MT-ATP6) is a laboratory-produced version of the mitochondrial-encoded subunit critical for the function of ATP synthase (Complex V), the enzyme responsible for mitochondrial ATP production. This subunit is integral to the F<sub>O</sub> domain, which facilitates proton translocation across the inner mitochondrial membrane during oxidative phosphorylation . Recombinant expression enables detailed biochemical and structural studies of this subunit’s role in energy transduction and mitochondrial pathologies .

Gene and Protein Overview

  • Gene: MT-ATP6 is encoded by mitochondrial DNA (mtDNA) and spans 681 base pairs in humans, with a 46-nucleotide overlap with MT-ATP8 .

  • Protein: The subunit weighs 24.8 kDa and comprises 226 amino acids in pigs. It forms part of the transmembrane F<sub>O</sub> sector, contributing to proton channel formation .

Domain Architecture

  • Transmembrane topology: Four α-helical bundles embedded in the mitochondrial membrane .

  • Functional motifs: Includes residues critical for proton translocation and interactions with the c-ring rotor .

Role in ATP Synthase

  • Proton channel: MT-ATP6 forms part of the F<sub>O</sub> proton channel, enabling proton flow to drive ATP synthesis in the F<sub>1</sub> domain .

  • Assembly: Requires coordination with nuclear-encoded subunits (e.g., ATP5H, ATP5A1) and assembly factors (e.g., TMEM70) .

Pathological Relevance

  • Disease associations: Mutations in MT-ATP6 are linked to Leigh syndrome, NARP syndrome, and mitochondrial encephalopathies .

  • Yeast models: Studies using S. cerevisiae homologs reveal how specific variants disrupt proton coupling .

Biochemical Studies

  • Proton transport assays: Recombinant MT-ATP6 is used to study proton translocation efficiency and inhibitor interactions (e.g., oligomycin) .

  • Structural modeling: Supports cryo-EM and X-ray crystallography efforts to resolve ATP synthase architecture .

Disease Modeling

  • Mitochondrial disorders: Recombinant proteins aid in characterizing pathogenic mutations (e.g., m.8993T>G in Leigh syndrome) .

  • Drug screening: Facilitates testing of therapies targeting ATP synthase dysfunction .

Recombinant Expression

  • System: E. coli-based cell-free expression ensures high yield and purity (>90%) .

  • Challenges: Proper folding requires co-expression with assembly factors (e.g., DAPIT, subunit 8) .

Table 2: Production Details

ParameterDescription
Expression RegionFull-length (1-226 residues)
Purity>90% (SDS-PAGE verified)
ApplicationsELISA, functional assays, antibody production

Clinical and Industrial Relevance

  • Diagnostics: Used to develop antibodies for detecting ATP synthase deficiencies in patient samples .

  • Biotechnology: Optimizing ATP synthase efficiency in synthetic biology applications .

Challenges and Future Directions

  • Structural instability: The hydrophobic nature of MT-ATP6 complicates solubilization and crystallization .

  • Heteroplasmy modeling: Developing systems to mimic mtDNA mutation load (e.g., 70–95% heteroplasmy in NARP/Leigh syndromes) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this requirement in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MNENLFASFIAPTMMGLPIVTLIIMFPSLLFPTPKRLINNRTISIQQWLIQLTSKQMMAI HNQKGQTWSLMLMSLIMFIGSTNILGLLPHSFTPTTQLSMNLGMAIPLWSATVFTGFRYK TKTSLAHFLPQGTPALLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLA LLNINTMTAFITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This proton gradient is produced by the electron transport complexes of the respiratory chain. F-type ATPases comprise two structural domains: F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel. These domains are connected via a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and potentially plays a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in mitochondrial function?

MT-ATP6 (Mitochondrially Encoded ATP Synthase Membrane Subunit 6) is a protein-coding gene that encodes a key component of mitochondrial ATP synthase (Complex V) . It contributes to the proton-transporting activity of ATP synthase through a rotational mechanism and is involved in mitochondrial ATP synthesis coupled with proton transport . The protein functions as part of the F0 domain, forming a critical component of the proton channel within the mitochondrial membrane .

The ATP6 protein is essential for the synthesis of ATP, which serves as life's "universal energy currency" and is responsible for fueling nearly all cellular processes, from nerve impulse propagation to DNA synthesis . MT-ATP6 may play a direct role in the translocation of protons across the membrane, which is crucial for the chemiosmotic mechanism of ATP production .

How does ATP synthase structure relate to its function?

ATP synthase consists of two major structural domains:

  • F1 domain: Contains the extramembraneous catalytic core

  • F0 domain: Contains the membrane proton channel

These domains are linked together by a central stalk and a peripheral stalk . During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation .

The MT-ATP6 gene encodes subunit a of ATP synthase, which forms part of the proton channel along with the c-ring . This channel facilitates the flow of protons across the mitochondrial membrane, which drives the rotational motion that powers ATP synthesis . The functional integration of these components allows for the efficient conversion of the proton gradient energy into chemical energy stored in ATP.

What diseases are associated with MT-ATP6 mutations?

MT-ATP6 mutations are associated with several mitochondrial disorders:

DiseaseClinical ManifestationsAssociated Mutations
Neuropathy, Ataxia, and Retinitis Pigmentosa (NARP)Neurodegeneration, vision lossVarious MT-ATP6 mutations
MT-ATP6-Related Mitochondrial Spastic ParaplegiaProgressive spasticitySpecific MT-ATP6 variants
Myoclonic Epilepsy with Cerebellar AtaxiaSeizures, movement disordersm.8782G>A; p.(Gly86*)
LeukodystrophyWhite matter abnormalitiesTruncating MT-ATP6 mutations
Renal DiseaseChronic kidney disease, renal failurem.8782G>A; p.(Gly86*), m.8618dup; p.(Thr33Hisfs*32)

Recent research has expanded the clinical and molecular spectrum of MT-ATP6-related disorders to include these additional phenotypes . MT-ATP6 has also been implicated in Leber hereditary optic neuropathy, Parkinson's disease, multiple sclerosis, and systemic lupus erythematosus, though these associations require further investigation .

What are the optimal storage conditions for recombinant pig ATP synthase proteins?

For recombinant pig ATP synthase proteins, the following storage conditions are recommended:

  • Long-term storage: -20°C to -80°C (with -80°C preferred for extended storage)

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • The default final concentration of glycerol is typically 50%

These conditions help maintain protein stability and functionality for accurate experimental results.

What methods are used to assess MT-ATP6 mutations' impact on ATP synthase function?

Several methodological approaches can be employed to assess the functional consequences of MT-ATP6 mutations:

  • Blue-native gel electrophoresis (BN-PAGE): Used to evaluate complex V assembly. Multiple bands observed in cultured fibroblasts and skeletal muscle tissue suggest impaired complex V assembly in patients with MT-ATP6 mutations .

  • Microscale oxygraphy: Measures oxygen consumption rates to assess:

    • Basal respiration (typically reduced with pathogenic mutations)

    • ATP synthesis capacity (often diminished)

    • Reactive oxygen species (ROS) generation (frequently increased)

  • Transmitochondrial cybrid cell studies: Useful for confirming pathogenicity of novel variants by transferring mitochondria from patient cells to rho-zero cells lacking mtDNA. This approach was used to confirm the deleterious effects of the m.8782 G>A; p.(Gly86*) mutation .

  • Yeast models: S. cerevisiae has been successfully used as a model organism to study the effects of variants in MT-ATP6 gene. This approach has helped understand how amino acid substitutions impact proton translocation through the channel formed by subunit a and the c-ring of ATP synthase at the molecular level .

How does heteroplasmy affect the expression and severity of MT-ATP6 mutations?

Heteroplasmy (the presence of both wild-type and mutant mtDNA in varying proportions) significantly impacts the expression and severity of MT-ATP6 mutations. Research has demonstrated that truncating MT-ATP6 mutations exhibit highly variable mutant levels across different tissue types .

Key considerations regarding heteroplasmy in MT-ATP6 research:

  • Tissue-specific variation: The proportion of mutant mtDNA can vary widely between different tissues in the same patient, contributing to the diverse clinical manifestations observed in MT-ATP6-related disorders .

  • Threshold effect: Clinical symptoms typically manifest when the proportion of mutated mtDNA exceeds a tissue-specific threshold. This threshold varies by tissue type, with highly aerobic tissues like brain, heart, and muscle typically having lower thresholds for dysfunction .

  • Genetic counseling implications: The variable distribution of mutant mtDNA across tissues is an important consideration during genetic counseling for patients with MT-ATP6 mutations. This variability contributes to the challenges in predicting disease progression and transmission risk .

  • Diagnostic approach: Multiple tissue sampling may be necessary for accurate molecular diagnosis of MT-ATP6-related disorders, as mutation load may be below detection threshold in some tissues while causing dysfunction in others .

What are the most effective model systems for studying MT-ATP6 function and pathology?

Several model systems have proven valuable for investigating MT-ATP6 function and disease mechanisms:

Model SystemAdvantagesLimitationsKey Applications
Yeast (S. cerevisiae)- Ease of genetic manipulation
- Rapid growth
- Well-characterized mitochondrial genetics
- Conservation of basic ATP synthase structure and function
- Differences in respiratory chain compared to mammals
- Limited utility for modeling tissue-specific effects
- Studying effects of mutations on proton translocation
- Molecular-level understanding of amino acid substitutions
Transmitochondrial cybrids- Contains human nuclear background
- Can directly test patient mutations
- Allows control of nuclear background
- Limited to cellular phenotypes
- May not recapitulate tissue-specific effects
- Confirming pathogenicity of novel variants
- Studying bioenergetic consequences of mutations
Patient-derived fibroblasts- Contains patient's nuclear and mitochondrial background
- Relatively accessible patient material
- May not express mitochondrial disease phenotypes
- Limited relevance to affected tissues
- Assessing complex V assembly
- Measuring bioenergetic parameters
Mouse models- Mammalian physiology
- Tissue-specific analyses possible
- Ability to study disease progression
- Differences in mtDNA genetic code
- Technically challenging to generate
- Expensive
- Investigating tissue-specific consequences
- Testing potential therapeutics

Research has demonstrated that yeast S. cerevisiae can be particularly effective for studying the effects of variants in MT-ATP6, providing insights into how substitutions impact proton translocation through the channel formed by subunit a and the c-ring of ATP synthase at the molecular level .

How do mutations in MT-ATP6 affect ATP synthesis and mitochondrial function?

Mutations in MT-ATP6, particularly truncating mutations, can have profound effects on ATP synthesis and broader mitochondrial function:

The severity of these effects often correlates with the mutation load (degree of heteroplasmy) and the specific nature of the mutation. Truncating mutations typically have more severe functional consequences than missense mutations .

What antibody selection criteria are important for MT-ATP6 research?

When selecting antibodies for MT-ATP6 research, consider the following criteria:

  • Specificity and reactivity: Choose antibodies with validated reactivity to the species under investigation. For example, antibody 68442-1-Ig has demonstrated reactivity with human and rat samples .

  • Application compatibility: Ensure the antibody is validated for your intended applications. For instance, the 68442-1-Ig antibody is recommended for Western Blot with dilutions of 1:5000-1:50000 .

  • Target epitope consideration:

    • For recombinant proteins, antibodies targeting conserved regions may provide better cross-species reactivity

    • Consider whether the antibody recognizes the native conformation or denatured forms of the protein

  • Validation data: Review the antibody's validation data, including:

    • Observed molecular weight (for ATP6, typically 25-30 kDa)

    • Positive detection in relevant tissues (e.g., heart tissue, liver tissue, cerebellum)

    • Published applications

  • Storage and handling: Follow manufacturer recommendations for optimal antibody performance:

    • Typical storage at -20°C in PBS with 0.02% sodium azide and 50% glycerol pH 7.3

    • Aliquoting may be unnecessary for -20°C storage

    • Stability generally maintained for one year after shipment

  • Titration optimization: It is recommended to titrate antibodies in each specific testing system to obtain optimal results, as optimal dilutions may be sample-dependent .

How do MT-ATP6 mutations influence mitochondrial membrane interactions?

The interactions between ATP synthase and the mitochondrial membrane environment represent an important frontier in understanding MT-ATP6 function and pathology:

  • Membrane curvature: ATP synthase oligomers play a critical role in shaping the inner mitochondrial membrane, particularly at the cristae tips. Mutations in MT-ATP6 might disrupt these interactions, potentially affecting mitochondrial ultrastructure .

  • Lipid environment effects: The lipid composition of the membrane can significantly influence ATP synthase function. Research suggests that considering interactions with the lipid environment is essential for a holistic understanding of ATP synthase function .

  • Proton movement pathways: The MT-ATP6 protein forms part of the proton channel, and its interaction with membrane lipids may affect proton translocation efficiency. The specific arrangement of subunit a relative to the c-ring and surrounding lipids creates the pathway for proton movement that drives ATP synthesis .

  • Membrane potential maintenance: Proper functioning of MT-ATP6 is crucial for maintaining the mitochondrial membrane potential. Mutations can disrupt this function, leading to membrane depolarization and mitochondrial dysfunction .

A holistic framework for studying ATP synthase requires consideration of these membrane interactions, as they may contribute to the pathophysiology of MT-ATP6-related disorders and could represent potential therapeutic targets .

What therapeutic approaches are being explored for MT-ATP6-related disorders?

While there are currently no approved targeted therapies for MT-ATP6-related disorders, several promising approaches are under investigation:

  • Genetic approaches:

    • Mitochondrial replacement therapy to prevent transmission of pathogenic mutations

    • Gene editing technologies adapted for mitochondrial DNA, though these face significant technical challenges due to the unique characteristics of mtDNA

  • Metabolic bypass strategies:

    • Supplementation with substrates that can enhance alternative ATP production pathways

    • Compounds that improve mitochondrial bioenergetics downstream of ATP synthase dysfunction

  • Mitochondrial biogenesis induction:

    • Approaches to increase mitochondrial mass and function

    • Targeting of "Transcriptional activation of mitochondrial biogenesis" pathways

  • Antioxidant therapies:

    • Compounds targeting increased ROS generation observed in MT-ATP6 mutations

    • Mitochondrially-targeted antioxidants that concentrate at the site of ROS production

  • Model systems for therapeutic development:

    • Yeast models have proven valuable for understanding the molecular consequences of MT-ATP6 mutations

    • These systems can potentially be leveraged for high-throughput screening of compounds that mitigate the effects of specific mutations

The heterogeneous nature of MT-ATP6 mutations and their variable tissue distribution presents significant challenges for therapeutic development, highlighting the importance of personalized approaches based on specific mutation characteristics and individual patient factors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.