Recombinant Pig B1 bradykinin receptor (BDKRB1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using an E. coli expression system, followed by affinity chromatography for purification ( ). Specifications include:

ParameterDescription
Expression SystemE. coli
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstitute in Tris/PBS buffer with 50% glycerol ( )
Reconstitution AdviceAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

Functional and Pharmacological Profile

BDKRB1 is functionally induced during inflammation or tissue injury and signals via Gq/11 proteins, elevating intracellular calcium to drive inflammatory responses ( ). Key findings:

  • Agonists: Lys-des-Arg⁹-bradykinin ( ).

  • Antagonists: LF22-0542 ( ), [Leu⁸]-des-Arg⁹-bradykinin ( ).

  • Pathways: Calcium signaling, neuroactive ligand-receptor interaction, and complement/coagulation cascades ( ).

In porcine models, BDKRB1 activity is upregulated in pre-existing infections, enhancing sensitivity to des-Arg⁹-bradykinin and implicating it in chronic inflammation ( ).

4.1. Drug Development

  • Fluorescent ligands (e.g., EGFP-(Asn-Gly)₁₅-Lys-des-Arg⁹-BK) enable real-time tracking of BDKRB1 in cancer and inflammation models ( ).

  • Antagonists are explored for pain management and diabetic complications ( ).

4.2. Disease Modeling

  • Diabetes: BDKRB1 knockout mice show reduced neutrophil apoptosis and hypoalgesia in streptozotocin-induced diabetes ( ).

  • Sepsis: Porcine studies link BDKRB1 to endotoxin-mediated vascular dysfunction ( ).

4.3. Antibody Production

  • Anti-BDKRB1 antibodies (e.g., Proteintech 26672-1-AP) are validated for Western blot (1:1000–1:4000) and immunohistochemistry (1:50–1:500) ( ).

Comparative Insights

SpeciesBDKRB1 Characteristics
Human36% homology to pig BDKRB1; associated with angioedema and end-stage renal disease ( ).
MouseUsed in knockout studies to elucidate inflammatory hyperalgesia ( ).
RatShares functional responses with pig BDKRB1 in calcium flux assays ( ).

Future Directions

  • Oncology: BDKRB1 is a potential biomarker for cancers with inflammatory microenvironments ( ).

  • Therapeutics: Targeting BDKRB1 may alleviate vascular permeability in sepsis or diabetes ( ).

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
BDKRB1; B1 bradykinin receptor; B1R; BK-1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MASQTLVVFQASNQSQLPPPNATLCDGAQEAWHLLHKVLPTCVVAICSGGLLGNLFVLSV FLVPRRRLNAAEIYLAHLAASDLVFALGLPFWAETIRNGFHWPFGAPLCRVVNGVIKANL FISIFLVVAISRDRYRALVHPVASWRRRRRRHWAQATCVLIWTAGGLLSIPTFLLRSVQV VPELNVSACVLPFPHEAWAFVRTVELNVLGFLLPLAAILFFNYHILAALRGREQLSRTRC GGPRDGKTTALILTLVAVFLLCWTPYHVCAFLEFLLHVRAIRGCFWEDFTDLGLQYTNFF AFINSCLNPVIYVFWGQLFRTKIWELYHRCLPRKLTAVSSSRRKEIFQIFWRN
Uniprot No.

Target Background

Function
This receptor serves as a binding site for bradykinin. It may play a role in chronic pain and inflammation.
Gene References Into Functions
  1. B1 receptors, when coupled with COX2, contribute to endothelium-independent contractions in endotoxin-treated pig coronary arteries PMID: 25258294
Database Links
Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and functional characteristics of pig BDKRB1?

Pig BDKRB1 (B1 bradykinin receptor) is a G-protein coupled receptor belonging to the rhodopsin family of peptide receptors. The protein consists of 330 amino acids arranged in the characteristic seven-transmembrane domain structure typical of GPCRs. The receptor contains an extracellular N-terminal domain, seven transmembrane helices (TM1-TM7), three extracellular loops (ECL1-3), three intracellular loops (ICL1-3), and an intracellular C-terminal domain . The pig BDKRB1 sequence includes critical regions for ligand binding, particularly in the transmembrane domains and extracellular loops that interact with des-Arg9-bradykinin and related peptides. Unlike the constitutively expressed B2 receptor, BDKRB1 is synthesized de novo following tissue injury or during inflammatory conditions. Receptor activation leads to an increase in cytosolic calcium ion concentration, ultimately resulting in chronic and acute inflammatory responses .

What are the key ligands that interact with pig BDKRB1 and their relative binding affinities?

The primary endogenous agonist for pig BDKRB1 is des-Arg9-bradykinin, a metabolite of bradykinin formed by the removal of the C-terminal arginine residue. Several synthetic peptides derived from des-Arg9-bradykinin have been characterized as either agonists or antagonists with varying affinities. The table below summarizes key ligands and their relative binding properties:

LigandTypeRelative AffinityNotes
des-Arg9-bradykininAgonistModeratePrimary endogenous agonist
Lys0-Leu8-des-Arg9-BKAntagonistHighSelective B1 antagonist used in cardiovascular studies
AcLys[D-βNal7, Ile8]des-Arg9-BKAntagonistVery High (pA2 8.5)Most active B1 receptor antagonist, partially resistant to enzymatic degradation
Sar-Tyr-εAhx-AcLys[D-βNal7, Ile8]des-Arg9-BKAntagonistHighN-terminal extension compatible with high antagonism

The presence of D-residues in position 7 of des-Arg9-bradykinin derivatives provides resistance to degradation by angiotensin-converting enzyme, enhancing the stability of these compounds for experimental use .

What are the optimal conditions for inducing BDKRB1 expression in pig tissue models?

BDKRB1 expression in pig tissues is optimally induced under inflammatory conditions. Research demonstrates that exposure to gram-negative bacteria or bacterial lipopolysaccharide (LPS) effectively triggers BDKRB1 expression within 4 hours of exposure . For in vivo models, standardized clinical evaluation of pigs with established bacterial infections has shown significant upregulation of functional B1 receptors. The induction process is time-dependent, with expression beginning within hours and reaching functional levels that can be detected through cardiovascular response assays to des-Arg9-bradykinin. When designing experiments to study induced BDKRB1, researchers should consider:

  • Baseline measurement of B1 receptor activity before induction

  • Appropriate LPS dosage (typically species and weight-adjusted)

  • Adequate time window (minimum 4 hours) for receptor expression

  • Control measurements using B2 receptor agonists (bradykinin) to confirm specificity

  • Confirmation of receptor expression using selective antagonists like Lys0-Leu8-des-Arg9-BK

The effectiveness of induction can be verified by comparing cardiovascular responses to des-Arg9-BK before and after the induction stimulus, with successful induction resulting in significantly enhanced responses similar to those observed in naturally infected animals .

How does the expression profile of BDKRB1 in pigs change during different inflammatory conditions?

The expression profile of BDKRB1 in pigs exhibits distinct patterns depending on the nature, duration, and severity of inflammatory stimuli. Studies comparing pigs with spontaneously acquired infections to those experimentally induced with LPS reveal important dynamics in receptor expression. In pigs with pre-existing infections, 88% demonstrated significantly increased sensitivity to des-Arg9-BK, indicating robust BDKRB1 expression . This contrasts with only 15% of healthy animals showing elevated responses, establishing a clear correlation between inflammatory status and receptor expression.

The temporal profile of expression follows a pattern of:

  • Initial absence in healthy tissue

  • De novo synthesis beginning within 4 hours of inflammatory stimulus

  • Progressive increase in receptor density over 12-24 hours

  • Sustained expression during persistent inflammation

  • Gradual reduction following resolution of the inflammatory stimulus

Interestingly, while B1 receptor expression is dramatically upregulated during inflammation, B2 receptor responsiveness remains relatively stable, as evidenced by consistent responses to bradykinin in both healthy and infected animals . This differential regulation provides important insights for researchers designing therapeutic interventions targeting kinin receptors in inflammatory conditions.

What molecular mechanisms control the induction of BDKRB1 in pig tissues following inflammatory stimuli?

The induction of BDKRB1 in pig tissues following inflammatory stimuli involves complex molecular signaling cascades. While the complete pathway has not been fully elucidated specifically in pigs, comparative studies with other species suggest that the mechanism involves:

  • Recognition of inflammatory stimuli (especially LPS from gram-negative bacteria) by pattern recognition receptors such as TLRs

  • Activation of pro-inflammatory transcription factors, primarily NF-κB

  • Binding of activated transcription factors to regulatory elements in the BDKRB1 gene promoter

  • De novo transcription and translation of BDKRB1 mRNA and protein

  • Trafficking of newly synthesized receptors to the cell membrane

This induction mechanism is particularly evident in cardiovascular tissues, where functional B1 receptors can be detected through physiological responses within hours of exposure to inflammatory stimuli . The selective nature of this induction is demonstrated by the fact that BDKRB1 expression increases dramatically while B2 receptor expression remains relatively stable. This differential regulation provides a useful experimental window for studying specific B1 receptor-mediated effects.

What expression systems yield the highest functional recovery of recombinant pig BDKRB1?

Multiple expression systems have been employed for producing recombinant pig BDKRB1, each with distinct advantages for different research applications. Based on comparative analysis, the following expression systems have demonstrated success:

Expression SystemYieldFunctional IntegrityAdvantagesLimitations
E. coliHighModerateCost-effective, rapid production, suitable for structural studies with His-tagging May require refolding, lacks mammalian post-translational modifications
Mammalian cells (HEK293)ModerateHighProper folding, post-translational modifications, ideal for functional studiesHigher cost, lower yield than bacterial systems
Baculovirus-insect cellHighHighCompromise between yield and functionalityMore complex system to establish

What are the most reliable methods for assessing BDKRB1 activation in experimental pig models?

Several complementary methods can be employed to reliably assess BDKRB1 activation in pig models, each offering distinct advantages for different research questions:

  • Cardiovascular Response Assays: The most physiologically relevant approach measures changes in blood pressure, vascular resistance, or heart rate following administration of selective B1 agonists like des-Arg9-bradykinin. This method has been successfully used to demonstrate B1 receptor functionality in infected pigs, with 88% showing enhanced responses compared to only 15% of healthy animals . Specificity can be confirmed using selective antagonists such as Lys0-Leu8-des-Arg9-BK.

  • Calcium Mobilization Assays: Given that BDKRB1 activation leads to increased cytosolic calcium, fluorescent calcium indicators in isolated cells or tissues can quantitatively measure receptor activation.

  • Phosphorylation of Downstream Effectors: Western blotting for phosphorylated ERK1/2, p38 MAPK, or other downstream signaling molecules provides a biochemical measure of receptor activation.

  • Receptor Internalization: Fluorescently labeled ligands or antibodies can track receptor trafficking following activation.

For comprehensive assessment, researchers should employ multiple methods, as each provides different insights into receptor function. The cardiovascular response model offers the advantage of measuring physiologically relevant outcomes in the context of the complete organism, making it particularly valuable for translational research .

What methodological approaches are recommended for studying structure-activity relationships of ligands interacting with pig BDKRB1?

Studying structure-activity relationships (SAR) of ligands interacting with pig BDKRB1 requires integrating multiple methodological approaches:

  • Peptide Modification and Synthesis: Systematic modification of des-Arg9-bradykinin derivatives by substituting specific amino acids at critical positions. Research has shown that modifications at positions 7 and 8, particularly using D-residues, dramatically influence binding affinity and resistance to enzymatic degradation. For example, replacement of Pro7 with D-Tic combined with various residues at position 8 produced B1 receptor antagonists with varying efficacies .

  • Competitive Binding Assays: Determining the affinity constant (pA2) of compounds using isolated tissue preparations (e.g., rabbit aorta or human umbilical vein as reference tissues) . These assays measure the concentration of antagonist required to shift the agonist concentration-response curve.

  • Functional Assays: Evaluating residual agonistic activities (αE) to detect partial agonism, which is essential for characterizing antagonist specificity. This is particularly important as some compounds developed as B1 antagonists have shown residual activity at B2 receptors .

  • Enzymatic Stability Testing: Incubating compounds with purified enzymes like angiotensin-converting enzyme to assess resistance to degradation. Studies have demonstrated that incorporating D-residues at position 7 significantly enhances peptide stability .

  • Molecular Modeling: Using the known sequence and predicted structure of pig BDKRB1 to model ligand-receptor interactions and guide rational design of new compounds.

By integrating these approaches, researchers have developed highly potent and selective B1 receptor antagonists such as AcLys[D-βNal7, Ile8]des-Arg9-bradykinin, which demonstrates high affinity (pA2 of 8.5), selectivity for B1 over B2 receptors, and partial resistance to enzymatic degradation .

How can pig BDKRB1 models contribute to understanding inflammatory disease mechanisms?

Pig BDKRB1 models offer significant advantages for understanding inflammatory disease mechanisms due to several unique characteristics of this system. The inducible nature of BDKRB1 during inflammatory conditions makes it an excellent marker and mediator of inflammation, allowing researchers to track the progression and resolution of inflammatory responses. Studies have demonstrated that 88% of pigs with pre-existing infections show enhanced B1 receptor activity, providing a physiologically relevant model that closely mimics natural infection processes .

Key contributions of pig BDKRB1 models include:

  • Validation of Inflammatory Disease Progression: The correlation between infection status and B1 receptor expression provides a quantifiable marker of inflammatory state, allowing objective assessment of disease progression and therapeutic intervention efficacy.

  • Differentiation of Acute vs. Chronic Inflammation: The temporal dynamics of BDKRB1 induction differ between acute and chronic inflammatory conditions, offering insights into the transition from acute to chronic inflammatory states.

  • Translational Relevance: Pigs share significant physiological and anatomical similarities with humans, making findings potentially more translatable than those from rodent models.

  • LPS Model Validation: Research has demonstrated that experimental LPS administration produces B1 receptor expression patterns similar to those observed in naturally occurring infections, validating this approach for controlled studies of inflammatory mechanisms .

  • Pharmacological Intervention Assessment: The availability of selective B1 antagonists like Lys0-Leu8-des-Arg9-BK enables mechanistic studies on the role of B1 receptors in propagating or resolving inflammation .

These models are particularly valuable for studying conditions characterized by chronic inflammation, including cardiovascular diseases, arthritis, and inflammatory bowel conditions, where B1 receptor activity may contribute to disease pathophysiology.

What are the key considerations when using recombinant pig BDKRB1 for drug discovery and pharmacological screening?

When utilizing recombinant pig BDKRB1 for drug discovery and pharmacological screening, researchers should consider several critical factors to ensure valid and translatable results:

  • Expression System Selection: The choice of expression system significantly impacts receptor functionality. While E. coli systems provide high yields suitable for structural studies , mammalian expression systems better preserve the receptor's native conformation and post-translational modifications essential for authentic pharmacological responses.

  • Species Differences in Pharmacology: Despite high conservation, subtle differences exist between pig and human BDKRB1 that may affect ligand binding profiles. For translational research, comparative studies using both species' receptors are recommended to identify species-specific pharmacological differences.

  • Inducible vs. Constitutive Expression: Unlike the constitutively expressed B2 receptor, BDKRB1 is induced during inflammation. Experimental designs must account for this by either:

    • Using pre-induced receptor in isolated tissue models from infected animals

    • Incorporating an induction step when using cell lines (typically using cytokines or LPS)

    • Creating constitutive expression systems for high-throughput screening, recognizing these may not fully recapitulate the native receptor context

  • Selectivity Profiling: Compounds should be screened against both B1 and B2 receptors to ensure selectivity. Research has shown that some compounds developed as B1 antagonists retain residual activity at B2 receptors .

  • Functional Assays: Binding affinity alone is insufficient; functional assays measuring downstream signaling (calcium mobilization, ERK phosphorylation) are essential to distinguish between antagonists, partial agonists, and biased ligands.

  • Metabolic Stability: Consider enzymatic degradation resistance, as natural kinins are rapidly degraded. Structure-activity studies have demonstrated that D-residues at position 7 enhance resistance to angiotensin-converting enzyme degradation .

By addressing these considerations, researchers can develop more effective screening campaigns leading to compounds with improved translational potential.

How can structural information about pig BDKRB1 inform the design of selective receptor modulators?

Structural information about pig BDKRB1 provides crucial insights for the rational design of selective receptor modulators. The known amino acid sequence of pig BDKRB1, consisting of 330 amino acids arranged in seven transmembrane domains with connecting loops , offers a foundation for structure-based drug design approaches. Key structural insights that inform modulator design include:

  • Transmembrane Domain Organization: The arrangement of the seven transmembrane helices creates a binding pocket that determines ligand specificity. The amino acid composition of this pocket in pig BDKRB1 can be leveraged to design complementary ligand structures with optimal spatial and electronic properties.

  • Extracellular Loop Regions: The extracellular loops, particularly ECL2, play a critical role in ligand recognition and binding. Structural analysis of these regions can identify key interaction points for enhancing selectivity between B1 and B2 receptors.

  • Structure-Activity Relationship Patterns: Previous studies have identified critical positions in des-Arg9-bradykinin derivatives that significantly impact B1 receptor binding. For instance:

    • Position 7 modifications, particularly with D-amino acids like D-βNal, enhance both binding affinity and metabolic stability

    • Position 8 substitutions with residues like Ile improve selectivity for B1 over B2 receptors

    • N-terminal modifications with groups like AcLys can further enhance antagonist potency

  • G-protein Coupling Interface: The intracellular regions that interact with G-proteins represent potential targets for designing biased ligands that selectively activate or inhibit specific signaling pathways.

  • Species-Specific Variations: Comparing pig BDKRB1 structure with human and other species can identify conserved regions critical for function versus variable regions that might be exploited for species-selective compounds.

The most successful approach to date has been the development of AcLys[D-βNal7, Ile8]des-Arg9-bradykinin, which exhibits high B1 receptor antagonism (pA2 of 8.5) and partial resistance to enzymatic degradation . This compound exemplifies how structural insights can lead to optimized pharmacological properties.

What are common challenges in expressing functional recombinant pig BDKRB1 and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant pig BDKRB1. These challenges and their solutions are summarized below:

ChallengeCauseSolution
Low expression yieldGPCR expression can be toxic to host cellsUse inducible expression systems; optimize codon usage for host; lower expression temperature
MisfoldingComplex transmembrane structureExpress in mammalian cells rather than E. coli; use fusion partners (e.g., MBP) to enhance solubility
Poor membrane localizationInefficient traffickingUtilize mammalian expression systems with proper post-translational machinery; consider chimeric constructs with well-expressed GPCRs
Ligand binding issuesImproper N-glycosylationExpress in cells capable of mammalian-like glycosylation; verify glycosylation pattern
Functional heterogeneityVariable post-translational modificationsStandardize culture conditions; use single-cell cloning to establish consistent lines
Degradation during purificationProtease sensitivityInclude protease inhibitors; perform purification at 4°C; optimize detergent selection

For E. coli expression systems, which offer high yields but may compromise functionality, adding fusion tags like His-tags can facilitate purification while potentially enhancing stability . For functional studies, mammalian expression systems (particularly HEK293 cells) provide the most physiologically relevant context despite lower yields. Regardless of the expression system chosen, verification of functionality through ligand binding assays or signaling readouts is essential before proceeding to experimental applications.

How should researchers interpret conflicting data between in vitro and in vivo BDKRB1 studies in pig models?

When faced with discrepancies between in vitro and in vivo BDKRB1 studies in pig models, researchers should consider several factors that might explain these differences:

  • Receptor Induction Status: BDKRB1 is not constitutively expressed but induced during inflammation. In vitro systems using cell lines with constitutive expression may not accurately represent the dynamic expression patterns observed in vivo. Studies have shown that only 15% of healthy pigs demonstrate B1 receptor activity, while 88% of infected animals show robust responses .

  • Receptor Microenvironment: The lipid composition, associated proteins, and other factors in the natural membrane environment significantly impact receptor conformation and function. In vitro systems may lack these contextual elements.

  • Ligand Metabolism: In vivo systems have active enzymatic processes that modify ligands. For example, angiotensin-converting enzyme rapidly degrades many bradykinin-related peptides unless they contain protective modifications like D-residues at position 7 .

  • Systemic Compensation: In vivo systems may compensate for receptor activation through counterregulatory mechanisms absent in isolated cell or tissue preparations.

  • Experimental Readouts: Different endpoints (e.g., calcium signaling in vitro versus blood pressure in vivo) may not directly correlate due to the complexity of physiological responses.

To reconcile conflicting data, researchers should:

  • Ensure consistent receptor induction conditions between in vitro and in vivo systems

  • Use selective B1 antagonists like Lys0-Leu8-des-Arg9-BK to confirm receptor specificity in both systems

  • Employ multiple readouts that measure related but distinct aspects of receptor function

  • Consider developing ex vivo systems (e.g., isolated organ preparations) that preserve tissue architecture while allowing more controlled experimental manipulation

By systematically addressing these factors, researchers can develop more coherent models integrating in vitro mechanistic insights with in vivo physiological relevance.

What statistical approaches are most appropriate for analyzing pig BDKRB1 receptor binding and functional data?

Analyzing pig BDKRB1 receptor binding and functional data requires appropriate statistical approaches tailored to the specific experimental design and data characteristics. The following methodologies are recommended based on data type:

  • Binding Affinity Studies:

    • For competitive binding data, nonlinear regression to determine IC50 values, which can be converted to Ki values using the Cheng-Prusoff equation

    • For kinetic binding studies, association and dissociation rate constants should be determined using exponential association/dissociation equations

    • Scatchard analysis or similar transformations may be used to assess binding site heterogeneity

  • Functional Assays:

    • For concentration-response curves, nonlinear regression to determine EC50/IC50 values and maximum responses

    • For antagonist studies, Schild analysis to determine pA2 values, which provide a measure of antagonist affinity independent of the specific agonist concentration used

    • When comparing responses between healthy and infected animals, appropriate parametric (t-test, ANOVA) or non-parametric tests based on data distribution

  • In Vivo Physiological Studies:

    • For cardiovascular responses, repeated measures ANOVA to account for baseline variations and time-dependent effects

    • Area under the curve (AUC) analyses for time-course data, particularly when comparing responses between different animal groups

    • Multiple comparison corrections (e.g., Bonferroni, Tukey's HSD) when comparing across multiple treatment groups

  • Receptor Expression Studies:

    • For qPCR data, relative quantification methods (ΔΔCt) with appropriate reference genes

    • For western blot or immunohistochemistry data, densitometry with normalization to housekeeping proteins

For all analyses, researchers should:

  • Clearly state sample sizes and power calculations

  • Test assumptions of statistical tests (normality, homogeneity of variance)

  • Report both statistical significance and effect sizes

  • Consider using more sophisticated approaches like mixed models when dealing with complex experimental designs with multiple sources of variation

What are promising areas for future research utilizing recombinant pig BDKRB1 models?

Several promising research directions leveraging recombinant pig BDKRB1 models could advance our understanding of inflammatory processes and therapeutic development:

  • Biased Signaling Exploration: Investigating whether different ligands induce distinct signaling patterns through BDKRB1 could reveal pathway-selective modulators. This "biased agonism" approach might allow targeting beneficial signaling pathways while avoiding detrimental ones.

  • Chronic Inflammation Models: The inducible nature of BDKRB1 during inflammation makes it an excellent model for studying the transition from acute to chronic inflammatory states. Pig models with controlled BDKRB1 induction could provide insights into this clinically relevant transition .

  • Receptor Heteromerization: Exploring potential interactions between BDKRB1 and other GPCRs (including B2 receptors) could reveal novel regulatory mechanisms and drug targets. Co-expression studies using differentially tagged receptors could identify physiologically relevant receptor complexes.

  • Translational Biomarkers: Developing methods to detect and quantify BDKRB1 expression in vivo could provide valuable biomarkers for inflammatory disease progression and therapeutic response. The strong correlation between infection status and B1 receptor expression in pigs (88% of infected animals showing enhanced responses) suggests potential translational applications.

  • Receptor Structure Determination: Although the amino acid sequence is known , determining the three-dimensional structure of pig BDKRB1 through crystallography or cryo-EM would dramatically accelerate structure-based drug design efforts.

  • Genome Editing Applications: CRISPR/Cas9 modification of the pig BDKRB1 gene could generate valuable models with altered receptor function or regulation, providing insights into the physiological role of specific receptor domains.

These research directions leverage the unique attributes of pig models, including their physiological similarity to humans and the well-characterized induction of BDKRB1 during inflammatory states .

How might advances in structural biology impact our understanding of pig BDKRB1 pharmacology?

Advances in structural biology stand to revolutionize our understanding of pig BDKRB1 pharmacology in several key ways:

These structural biology advances would complement existing knowledge about pig BDKRB1 sequence and pharmacology , providing a more comprehensive framework for understanding receptor function and developing therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.