Recombinant Pig Bcl-2-like protein 1 (BCL2L1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The BCL2L1 gene encodes for the BCL2L1 protein . Through alternative splicing, this gene gives rise to two primary isoforms: Bcl-xL (long isoform) and Bcl-xS (short isoform) . The BCL2L1 protein is located on the outer mitochondrial membrane, where it regulates the opening of voltage-dependent anion channels (VDACs) .

Function and Mechanism of Action

  1. Regulation of Apoptosis BCL2L1 plays a pivotal role in the regulation of apoptosis. The longer isoform, Bcl-xL, acts as an apoptotic inhibitor, preventing cell death, while the shorter isoform, Bcl-xS, functions as an apoptotic activator, promoting cell death .

  2. Mitochondrial Membrane Control The protein regulates outer mitochondrial membrane channels, specifically VDACs, which control mitochondrial membrane potential. This regulation influences the production of reactive oxygen species and the release of cytochrome C, both of which are potent inducers of cell apoptosis .

  3. Interaction with Other Proteins BCL2L1 interacts with various proteins, influencing cell survival and death pathways . It inhibits the activation of caspases, which are essential for apoptosis, and regulates cell death by blocking VDACs, preventing the release of the caspase activator CYC1 from the mitochondrial membrane .

Production and Availability

Recombinant Pig BCL2L1 can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells .

FeatureDescription
Production SourceYeast, E. coli, Baculovirus, Mammalian cell
ApplicationsResearch and development in cell biology, apoptosis studies, drug discovery
PurityHigh purity
ModificationsAvailable with Avi-tag Biotinylated E. coli biotin ligase for specific applications
AvailabilityInquire from suppliers for size and specific requirements

Role in Cancer

  1. Drug Resistance Alterations in BCL2L1 can contribute to drug resistance in cancer cells . For instance, amplification of BCL2L1 has been detected in gastric cancer cases, suggesting its role in promoting cell survival despite drug treatment .

  2. Therapeutic Target Given its involvement in apoptosis, BCL2L1 is a potential therapeutic target. Studies have identified that methylation of BCL2L1 is associated with sensitivity to MCL1 inhibitors, suggesting that BCL2L1 methylation status could predict the response to these inhibitors in certain cancers .

  3. Survival of Pancreatic Cells BCL-xL/BCL2L1 is critical for the survival of differentiating pancreatic cells from human pluripotent stem cells . Knockdown of BCL2L1 in pancreatic progenitors leads to higher cell death and downregulation of pancreatic genes .

Clinical Significance

  1. Myelomonocytic AML The ratio of ATP1A1/BCL2L1 is associated with myelomonocytic and monocytic acute myeloid leukemia (AML) phenotypes . The ATP1A1/BCL2L1 ratio improves the prediction of sensitivity .

  2. Cisplatin Resistance The β-catenin/BCL2L1 axis may play a vital role in cisplatin resistance . Higher expression of BCL2L1 is associated with poor survival in patients treated with cisplatin .

  3. Therapeutic Implications Research indicates that targeting BCL2L1 could be a viable strategy in treating cancers, especially when combined with other therapeutic approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
BCL2L1; BCLX; BLC2L; Bcl-2-like protein 1; Bcl2-L-1; Apoptosis regulator Bcl-X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
Uniprot No.

Target Background

Function
A potent inhibitor of cell death, BCL2L1 inhibits caspase activation. Its mechanism involves blocking the voltage-dependent anion channel (VDAC), preventing the release of the caspase activator CYC1 from the mitochondrial membrane. Furthermore, it regulates the G2 checkpoint and cytokinesis during mitosis. BCL2L1 also regulates presynaptic plasticity, influencing neurotransmitter release and recovery, axonal mitochondrial number, and the size and number of synaptic vesicle clusters. During synaptic stimulation, it enhances mitochondrial ATP availability by modulating mitochondrial membrane ATP synthase F(1)F(0) activity. It also regulates endocytic vesicle retrieval in hippocampal neurons through interaction with DMN1L and stimulation of its GTPase activity in synaptic vesicles. Finally, it may attenuate inflammation by impairing NLRP1-inflammasome activation, thereby reducing CASP1 activation and IL1B release.
Gene References Into Functions
  1. In a swine model of ischemia and reperfusion injury, interleukin-6, endothelin ET-1, and apoptotic Bak and Bcl-XL genes play roles in small bowel transplantation. [PMID: 21884347](https://www.ncbi.nlm.nih.gov/pubmed/21884347)
  2. Bcl-xL levels were significantly lower in haploid parthenotes compared to diploid parthenotes, suggesting that the haploid state affects apoptosis-related gene expression, leading to increased apoptosis. [PMID: 15984157](https://www.ncbi.nlm.nih.gov/pubmed/15984157)
  3. Apoptosis is involved in follicular atresia; Bcl-2 is induced by warm ischemia; and cryopreservation, with short tissue preparation times, does not alter apoptotic signals. [PMID: 16616078](https://www.ncbi.nlm.nih.gov/pubmed/16616078)
  4. Cysteine reduced the expression of pro-inflammatory cytokines (TNF-alpha, IL-6, IL-12p40, IL-1beta), while increasing the expression of the apoptosis initiator caspase-8 and bcl2L1. [PMID: 19520150](https://www.ncbi.nlm.nih.gov/pubmed/19520150)
Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein; Cytoplasmic side. Mitochondrion matrix. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytosol. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane.

Q&A

What is porcine BCL2 and how does it compare to BCL2 in other species?

Porcine BCL2 is a 26-kDa anti-apoptotic protein that plays a crucial role in cell survival and resistance to apoptosis. The protein contains four major conserved domains: BH1, BH2, BH3, and BH4, which are highly similar across species including humans and mice. The most significant differences between porcine BCL2 and its counterparts in other species are found in the N-terminal loop region between positions 50-80, specifically between the BH3 and BH4 domains . This region has been previously reported to interact with Nur77 and influence the anti-apoptotic effect of BCL2 .

Despite these structural differences, functional studies demonstrate that porcine BCL2 maintains strong anti-apoptotic capabilities similar to human and mouse versions, suggesting that this loop region may not be the core element of BCL2's anti-apoptotic mechanism in pluripotent stem cells . The high conservation of the major functional domains indicates evolutionary importance of BCL2's role in cellular survival across mammalian species.

How does BCL2 overexpression affect porcine induced pluripotent stem cell (piPSC) survival?

Overexpression of porcine BCL2 significantly enhances the survivability of piPSCs, particularly under stress conditions. Research demonstrates that BCL2-expressing piPSCs exhibit fewer dead cells compared to control groups, with the anti-apoptotic effect becoming especially pronounced in the late stages of culture . This survival advantage is maintained even when cells are subjected to stress conditions such as reduced serum or growth factor concentrations.

Specifically, BCL2 overexpression allows piPSCs to survive in media containing as little as 1% knockout serum replacement (KSR), conditions under which control cells undergo extensive apoptosis . Similarly, when fibroblast growth factor 2 (FGF2) is removed from the culture medium, control piPSCs show significant proliferation inhibition and severe cell death, while BCL2-overexpressing cells demonstrate markedly improved survival . The anti-apoptotic effect is quantifiable, with BCL2-expressing cells showing significantly reduced levels of cleaved caspase-3 (an apoptosis marker) compared to control cells .

What signaling pathways mediate BCL2's effects in piPSCs?

BCL2 exerts its anti-apoptotic effects through multiple signaling pathways in piPSCs, with the PI3K-AKT pathway playing a particularly important role. Transcriptomic analysis through RNA-seq reveals that BCL2 overexpression upregulates genes primarily involved in the PI3K-AKT signaling pathway and focal adhesion pathway . This represents a novel regulatory mechanism, as BCL2 is traditionally viewed as a downstream effector of the PI3K pathway rather than an upstream activator.

The experimental evidence indicates that BCL2 increases the expression of PI3K signaling pathway receptors, particularly FGFR2 (fibroblast growth factor receptor 2) . This creates a positive feedback loop where BCL2 enhances the cells' responsiveness to FGF2, a critical factor for piPSC maintenance. The essential nature of this pathway is demonstrated by experiments using LY294002, a PI3K inhibitor, which abolishes the protective effects of BCL2 overexpression . Additionally, BCL2 enhances oxidoreductase activity and lipid metabolism pathways, which contribute to improved survival under oxidative stress conditions commonly encountered during cell culture and differentiation .

How does BCL2 affect embryoid body formation from piPSCs?

BCL2 overexpression substantially improves both the quantity and quality of embryoid bodies formed from piPSCs. When subjected to embryoid body formation protocols, BCL2-overexpressing piPSCs produce significantly more embryoid bodies that are larger in diameter compared to control cells . One striking observation is the marked reduction in the number of dead cells at the edges of embryoid bodies derived from BCL2-piPSCs compared to control groups .

The enhanced viability extends beyond the suspension culture phase. After 5 days in adherent culture following embryoid body formation, BCL2-overexpressing cells demonstrate significantly higher survival rates than control cells . This indicates that BCL2's protective effects persist through the differentiation process, potentially allowing for more efficient directed differentiation protocols. The improved embryoid body formation capability suggests that BCL2 overexpression could be a valuable strategy for enhancing the differentiation potential of piPSCs in various applications, including the development of in vitro disease models and regenerative medicine approaches.

What molecular interactions occur between BCL2 and pro-apoptotic factors in piPSCs?

The downstream effects of this favorable ratio are evident in the reduced activation of effector caspases. Western blot analysis demonstrates that the expression of cleaved caspase-3 (the activated form of this executioner caspase) is significantly lower in BCL2-overexpressing piPSCs compared to control cells . This indicates effective inhibition of the intrinsic apoptotic pathway. Additionally, BCL2 appears to promote cell survival through mechanisms beyond direct protein-protein interactions with pro-apoptotic factors, including enhancement of cellular metabolic processes and resistance to oxidative stress .

How does BCL2 overexpression influence interspecific chimeric potential of piPSCs?

BCL2 overexpression significantly enhances the survival and integration capacity of piPSCs in interspecific chimeric embryos. In experiments where GFP-labeled piPSCs were injected into mouse embryos at the 8/16-cell stage, BCL2-overexpressing cells showed markedly improved survival compared to control cells . The GFP signal intensity was substantially stronger in chimeric blastocysts containing BCL2-piPSCs than in those with control piPSCs, indicating greater cell survival .

The survival advantage of BCL2-overexpressing cells persists through multiple stages of embryonic development:

Embryonic DayBCL2-piPSCs SurvivalControl piPSCs SurvivalObservations
E3.5 (blastocyst)Strong GFP signal, cells localized in ICMWeak GFP signalBCL2-piPSCs successfully locate in inner cell mass region
E4.5 (hatching)Strong GFP signal maintainedVery weak GFP signalMost control cells died during development
E5.543.33% survival rate29.4% survival rateStatistically significant difference in survival
E6.5Detectable GFP fluorescenceNo surviving cellsBCL2-piPSCs persist longer in host embryos

Despite the improved survival, important limitations were observed. The BCL2-piPSCs remained as clone-like clusters rather than dispersing and integrating with mouse embryonic cells . This suggests that while BCL2 enhances survival, it may not overcome all interspecies compatibility barriers necessary for complete chimeric integration and development .

What is the relationship between BCL2, FGFR2, and FGF signaling in piPSCs?

BCL2 overexpression establishes a positive feedback loop with the FGF signaling pathway through upregulation of FGFR2 (fibroblast growth factor receptor 2). RNA-seq analysis reveals that BCL2-overexpressing piPSCs demonstrate significantly increased expression of FGFR2 compared to control cells, which is further confirmed by quantitative PCR . This represents a novel regulatory mechanism, as BCL2 is typically considered a downstream effector of growth factor signaling rather than a regulator of receptor expression.

The functional significance of this FGFR2 upregulation is demonstrated by experiments manipulating FGF2 concentration in the culture medium. When FGF2 is removed from the medium, control piPSCs exhibit pronounced cell death and proliferation inhibition . In contrast, BCL2-overexpressing cells show significant resistance to FGF2 withdrawal, maintaining better survival and growth characteristics . This suggests that BCL2-induced FGFR2 upregulation increases the sensitivity of cells to residual or autocrine FGF signals, creating a more robust signaling system.

How does BCL2 affect cellular metabolism and oxidative stress response in piPSCs?

BCL2 overexpression fundamentally alters the metabolic profile and oxidative stress response of piPSCs. Transcriptomic analysis reveals that BCL2 upregulates genes involved in oxidoreductase activity and lipid metabolism . These metabolic changes appear to contribute significantly to the enhanced survival capacity of BCL2-overexpressing piPSCs.

The oxidoreductase activity enhancement is particularly noteworthy, as oxidative stress is a major cause of apoptosis during cell culture and differentiation. By upregulating genes involved in managing reactive oxygen species and other oxidative stressors, BCL2 provides piPSCs with improved resilience against common culture-induced stresses . This mechanism appears consistent with BCL2's anti-apoptotic function in other cell types, suggesting a conserved role in oxidative stress management.

The upregulation of lipid metabolism genes by BCL2 represents a potentially porcine-specific adaptation. Previous research has established that lipid metabolism plays a more critical role in porcine embryonic development compared to mouse development . Therefore, BCL2's enhancement of lipid metabolism may not only improve general cell survival but also specifically support metabolic requirements unique to porcine pluripotent cells . This metabolic adaptation could contribute to the slightly enhanced pluripotency characteristics observed in BCL2-overexpressing piPSCs compared to the more neutral effect on pluripotency seen in mouse and human studies .

What are the transcriptional changes induced by BCL2 overexpression in piPSCs?

BCL2 overexpression induces specific and directional transcriptional changes in piPSCs. RNA sequencing analysis reveals a total of 70 differentially expressed genes following BCL2 overexpression, with a strong bias toward upregulation (58 upregulated vs. 12 downregulated genes) . This pattern indicates that BCL2 primarily acts by promoting the expression of genes that enhance cell survival rather than by suppressing pro-apoptotic genes.

Among the significantly upregulated genes, several key factors stand out:

  • FGFR2: A receptor for FGF2 that amplifies FGF signaling, promoting survival and pluripotency maintenance

  • BMP5: Member of the bone morphogenetic protein family involved in development and pluripotency regulation

  • CD9: Cell surface protein associated with cell adhesion and pluripotency in stem cells

  • Genes involved in oxidoreductase activity: Enhance resistance to oxidative stress

  • Lipid metabolism genes: Support metabolic needs specific to porcine cells

Notably, the overexpression of BCL2 does not significantly alter the expression of core pluripotency factors . This suggests that BCL2 enhances piPSC survival without fundamentally changing their pluripotent identity, which aligns with findings in human and mouse pluripotent stem cells . The selective nature of these transcriptional changes highlights BCL2's role as a targeted regulator of survival pathways rather than a broad modifier of cell identity.

What are the limitations of BCL2 overexpression for interspecific chimera development?

Despite the significant survival advantages conferred by BCL2 overexpression, important limitations exist in using BCL2-piPSCs for interspecific chimera development. The most notable limitation is that BCL2-piPSCs fail to fully integrate and develop synchronously with host embryonic cells . When injected into mouse embryos, BCL2-piPSCs remain as distinct clone-like clusters rather than dispersing throughout the developing embryo .

Additionally, the presence of BCL2-piPSCs was observed to significantly affect the hatching process of mouse embryos . This interference with normal embryonic development represents a serious constraint on the utility of these cells for generating viable interspecific chimeras.

The limited integration likely stems from fundamental interspecies compatibility barriers that BCL2 overexpression alone cannot overcome. Recent research has identified unique signaling networks in porcine early embryonic development that differ from those in mice . These developmental differences may create insurmountable obstacles for true functional integration of porcine cells into mouse embryos, regardless of their enhanced survival capacity .

While BCL2 overexpression represents a significant advancement in promoting piPSC survival in heterologous environments, complementary approaches addressing developmental compatibility will be necessary to achieve full interspecific chimeric potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.