Recombinant Pig Bestrophin-1 (BEST1)

Shipped with Ice Packs
In Stock

Description

General Information

Bestrophin-1 (BEST1) is a 68 kDa transmembrane protein that belongs to the bestrophin family of anion channels . It is predominantly expressed in the basolateral membrane of the retinal pigment epithelium (RPE) . BEST1 is a Ca2+-activated Cl- channel (CaCC) . When purified from porcine RPE, bestrophin-1 exists as a dimer .

Structure and Function

BEST1, or bestrophin-1, is a 585 amino acid transmembrane protein located close to the basolateral membrane of the RPE . BEST1 functions as a Cl- channel when expressed in HEK293 cells . It also alters the activity of L type Ca2+ channels when expressed in RPE-derived cells, suggesting it might also act to regulate entry of Ca2+ into RPE cells .

The channel is a highly conserved pentamer with a flower vase-shaped ion conducting pathway as indicated by structures of homologs from Klebsiella pneumoniae (KpBEST), chicken (cBEST1), and bovine (bBEST2) .

Mutations and Associated Diseases

Mutations in the human BEST1 gene lead to retinal degenerative diseases, displaying progressive vision loss and even blindness . Over 100 different BEST1 mutations have been described . Disease-causing mutations associated with bestrophinopathies include adult vitelliform macular dystrophy (AVMD), autosomal recessive bestrophinopathy (ARB), autosomal dominant vitreoretinochoroidopathy (ADVIRC), and retinitis pigmentosa (RP) .

Research Findings

  • Oligomerization: BEST1 is thought to exist as an oligomer . All mutants tested could reciprocally co-immunoprecipitate and exhibit FRET with wild-type BEST1, suggesting unimpaired oligomerization . The first ~174 amino acids are sufficient for the formation of oligomers with wild-type BEST1 .

  • Localization: RP- and ADVIRC-associated mutants were properly localized to the basolateral plasma membrane of cells, while two AVMD and most ARB mutants were mislocalized . Mislocalization of BEST1 is not an absolute feature of any individual bestrophinopathy, occurring in AVMD, BVMD, and ARB .

  • Y227N Mutation: The Y227N mutation affects BEST1 protein stability and function . Knock-in animals demonstrated a severe phenotype in the male reproductive tract and degradation of mutant BEST1 protein in the testis was associated with adverse effects on sperm motility and the capability to fertilize eggs .

  • BEST1 as a Drug Target: The malarial PfA-M1 metallo-aminopeptidase is considered a putative drug target, and bestatin is a potent inhibitor of PfA-M1 .

  • Gene Transfer: Recombinant adeno-associated virus (AAV)-mediated BEST1 transfer to the retinal pigment epithelium (RPE) can be performed without adverse effects in the RPE or neuroretina .

Tables

DiseaseAssociated MutationLocalization
Adult Vitelliform Macular Dystrophy (AVMD)BEST1Mislocalized in some cases
Autosomal Recessive Bestrophinopathy (ARB)BEST1Mislocalized in most cases
Autosomal Dominant Vitreoretinochoroidopathy (ADVIRC)BEST1Properly localized to the basolateral plasma membrane of cells
Retinitis Pigmentosa (RP)BEST1Properly localized to the basolateral plasma membrane of cells

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
BEST1; VMD2; Bestrophin-1; Vitelliform macular dystrophy protein 2 homolog; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
BEST1
Target Protein Sequence
PQHLVKAGFMTPSEHKHLEKLSLPHNSFWMPWVWFANLSTKAWIGGRIRDPVLLQSLLDE MNTLRTQCGHLYAYDWISVPLVYTQVVTVAVYSFFLACLVGRQFLNPAKAYPGHEMDLVV PLFTFLQFFFYAGWLKVAEQLINPFGEDDDDFETNWIVDRSLQVSLSAVDEMHHDLPPME RDMYWNDPEPHPPYTAASAQSRRPSFFGSTFNISLGKEDMEFQPEEEEEAHTGILGHFLG LQSSDHQPPRTNSKTKLLWPKKEGHFHEGHPKNLRGARLDSSDQEDSKAWREGGFKSAAL CGRPGYHSAPQTPLGHTPMVFPPEESAPLGLRRVSGIDEAAKDQSLQPATPSIKKSFELL PESAEASAEPLQGSHVRRKTVEFNLADLSEAPEHLKEPNLEPPMGIHAILKDHRDPYWAL ENRDEAHS
Uniprot No.

Target Background

Function
Recombinant Pig Bestrophin-1 (BEST1) forms calcium-sensitive chloride channels and is permeable to bicarbonate.
Database Links
Protein Families
Bestrophin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.

Q&A

What is Bestrophin-1 and why is porcine BEST1 important for research?

Bestrophin-1 is a Ca²⁺-activated Cl⁻ channel (CaCC) predominantly expressed in retinal pigment epithelium (RPE) cells. BEST1 forms a pentameric structure with a flower vase-shaped ion conducting pathway, as determined through homolog studies from various species . Porcine BEST1 is particularly valuable in research due to its high structural and functional similarity to human BEST1, making it an excellent model for studying bestrophinopathies. Porcine RPE cells have been used to investigate the role of BEST1 as a physiological CaCC, though there are competing theories about whether BEST1, TMEM16A, or TMEM16B serves as the primary CaCC in RPE . Research with knockout models has conclusively demonstrated that BEST1 is the bona fide CaCC in human RPE, and similar findings apply to porcine models .

How does the structure of recombinant pig BEST1 compare to human BEST1?

While the human BEST1 structure has not been fully solved, high-resolution structures of homologs from Klebsiella pneumoniae (KpBEST), chicken (cBEST1), and bovine (bBEST2) indicate that the channel is a highly conserved pentamer . Porcine BEST1 shares significant structural similarity with human BEST1, making it suitable for comparative studies. The pentameric assembly of BEST1 channels is critical for understanding how mutations affect channel functionality, as the number of mutant protomers required for displaying a phenotype could theoretically be 1, 2, 3, 4, or 5 . This has important implications for studying dominant versus recessive mutations in bestrophinopathies.

What expression systems are most effective for producing recombinant pig BEST1?

For recombinant pig BEST1 expression, several systems have proven effective in research settings. Based on methodologies used for human BEST1, the baculovirus expression system has shown success for both wild-type and mutant BEST1 proteins . This system allows for controlled expression and has been utilized in conjunction with CRISPR/Cas9-mediated gene editing approaches. For functional studies, human pluripotent stem cell-derived RPE (hPSC-RPE) cells have been utilized as a model system to study BEST1 function, and similar approaches can be applied to pig BEST1 studies . Transient transfection in HEK293 cells has also been employed for comparative studies of BEST1 mutations, which could be adapted for pig BEST1 research .

How can recombinant pig BEST1 be used to model human bestrophinopathies?

Recombinant pig BEST1 can serve as a valuable tool for modeling human bestrophinopathies through several advanced approaches:

  • Mutation Modeling: Introducing equivalent human disease-causing mutations into recombinant pig BEST1 allows researchers to study their effects on channel function . This is particularly useful for understanding both loss-of-function and gain-of-function mutations.

  • Dominant Effect Analysis: Studies with human BEST1 have shown that different mutations require varying mutant-to-wild-type molecule ratios for phenotypic manifestation . Similar analyses with pig BEST1 can help understand the dominant effects of mutations, which is critical for developing effective therapies.

  • Pentameric Assembly Studies: Since BEST1 forms pentameric channels, recombinant pig BEST1 can be used to study how different combinations of mutant and wild-type protomers affect channel function, which has implications for understanding disease mechanisms .

  • Comparative Electrophysiology: Ca²⁺-dependent Cl⁻ current measurements in cells expressing recombinant pig BEST1 can be compared with human BEST1 to validate porcine models for drug screening and therapeutic development .

What are the key differences between studying loss-of-function versus gain-of-function mutations in recombinant pig BEST1?

Research on human BEST1 has revealed fundamental differences between loss-of-function and gain-of-function mutations that would likely apply to pig BEST1 studies:

CharacteristicLoss-of-Function MutationsGain-of-Function Mutations
Channel ActivitySignificantly reduced Cl⁻ currentsEnhanced channel activity
Dominant EffectOften behave recessively at 1:1 ratio with WTStrong dominant effect even at 1:4 ratio with WT
Rescue StrategyEffectively rescued by gene augmentationRequires combination of gene augmentation with CRISPR/Cas9-mediated knockdown
Protomer RequirementMay require 2-4 mutant protomers per pentamerMay require only 1 mutant protomer per pentamer
Allelic ExpressionMay depend on allelic expression imbalanceLess dependent on allelic expression imbalance

Loss-of-function mutations often require a higher mutant-to-wild-type ratio (typically 4:1) to exhibit dominant-negative effects, while gain-of-function mutations can dominate channel function even at lower ratios (1:4) . This distinction is crucial when designing rescue strategies, as gene augmentation alone is sufficient for loss-of-function mutations but ineffective for gain-of-function mutations, which require both knockdown of the mutant protein and augmentation with wild-type BEST1 .

How does allelic expression imbalance affect studies with recombinant pig BEST1?

Studies with human BEST1 have demonstrated that allelic expression imbalance (AEI) plays a significant role in bestrophinopathy development . When studying recombinant pig BEST1, researchers should consider:

  • Transcriptional Regulation: Imbalanced transcription of the two endogenous BEST1 alleles has been detected in human donor-derived iPSC-RPE and native RPE cells . Similar imbalances might exist in porcine models.

  • Mutation Classification: Some autosomal dominant loss-of-function mutations in BEST1 may actually behave recessively when co-expressed with wild-type BEST1 at a 1:1 ratio, but exhibit a dominant-negative effect when the mutant allele is expressed at higher levels than the wild-type allele .

  • Experimental Design Implications: When using recombinant pig BEST1 to model human disease, researchers should carefully control the expression ratios of mutant to wild-type proteins to accurately reflect the disease state .

  • Quantification Challenges: There is currently a lack of quantitative approaches to distinguish BEST1 missense variants from wild-type counterparts at the protein level, which complicates the study of endogenous mutant-to-wild-type ratios in disease models .

What electrophysiological approaches are most suitable for studying recombinant pig BEST1 function?

To effectively assess the function of recombinant pig BEST1 channels, researchers should consider these key methodological approaches:

  • Whole-Cell Patch Clamp: This technique is essential for measuring Ca²⁺-dependent Cl⁻ currents mediated by BEST1 channels. Studies on human BEST1 have used varying intracellular Ca²⁺ concentrations (0, 0.1, 1.2, and 4.5 μM [Ca²⁺]ᵢ) to assess channel activity across different conditions . Similar protocols would be suitable for pig BEST1.

  • Current-Voltage Relationship Analysis: Measuring currents at different membrane potentials helps characterize the biophysical properties of BEST1 channels, which is particularly important when comparing wild-type and mutant channels .

  • Calcium Sensitivity Assays: As BEST1 is a Ca²⁺-activated channel, determining the calcium sensitivity of recombinant pig BEST1 using dose-response experiments is crucial for functional characterization .

  • Control Experiments: When conducting electrophysiological studies, appropriate controls are essential, including measurements in cells lacking BEST1 expression and cells expressing other potential CaCCs like TMEM16A or TMEM16B to confirm specificity .

What expression verification methods should be used when working with recombinant pig BEST1?

Proper verification of recombinant pig BEST1 expression is critical for ensuring experimental validity. Based on practices used for human BEST1, the following methods are recommended:

  • Immunoblotting: Western blot analysis using BEST1-specific antibodies can verify protein expression and quantify relative levels of wild-type and mutant BEST1 . Antibodies that recognize both human and porcine BEST1, such as the E6-6 antibody (BSA-free), have been reported in the scientific literature .

  • Immunocytochemistry/Immunofluorescence: This technique can confirm the subcellular localization of BEST1, which is important for assessing whether mutations affect protein trafficking .

  • RT-qPCR: Quantitative PCR can measure BEST1 mRNA levels and is particularly useful for studying allelic expression imbalance between wild-type and mutant BEST1 .

  • Co-expression Verification: When studying the effects of mutations, it's important to verify the co-expression of wild-type and mutant BEST1 at the intended ratios, which can be achieved using tagged proteins (e.g., GFP or mCherry fusions) .

How can CRISPR/Cas9 gene editing be optimized for studying recombinant pig BEST1?

CRISPR/Cas9 technology offers powerful approaches for studying BEST1 function and developing potential therapies. Based on research with human BEST1, the following strategies can be applied to pig BEST1 studies:

  • Knockout Models: Generation of BEST1-knockout cell lines provides valuable negative controls for functional studies and confirms the specificity of observed Cl⁻ currents .

  • Knockin Mutations: CRISPR/Cas9 can be used to introduce specific mutations into endogenous pig BEST1 to create more physiologically relevant disease models .

  • Combined Silencing/Augmentation Approach: For studying gain-of-function mutations, a dual approach involving CRISPR/Cas9-mediated knockdown of endogenous BEST1 combined with expression of recombinant wild-type BEST1 has proven effective . This approach involves:

    • Designing gRNAs targeting endogenous BEST1

    • Expressing these gRNAs along with Cas9 using a baculovirus-based silencing (BVSi) vector system

    • Co-expressing a "wobble" version of wild-type BEST1 that is resistant to the gRNA

    • Verifying knockdown and expression by immunoblotting

  • gRNA Design Considerations: When designing gRNAs for BEST1 targeting, researchers should consider:

    • Target specificity to avoid off-target effects

    • Efficiency of knockdown

    • Compatibility with "wobble" sequence design for rescue experiments

How should researchers interpret contradictory findings between recombinant pig BEST1 and human BEST1 studies?

When encountering discrepancies between pig and human BEST1 research results, consider the following analytical framework:

  • Species-Specific Differences: While pig and human BEST1 share significant homology, subtle structural differences may affect channel function, interactions with regulatory proteins, or responses to mutations .

  • Expression System Variables: Results may vary depending on whether studies use transient transfection, stable cell lines, or native RPE cells. HEK293 cells provide a clean background for channel function studies but lack the native RPE environment, while iPSC-RPE or hPSC-RPE models better represent physiological conditions .

  • Experimental Condition Differences: Variations in intracellular Ca²⁺ concentrations, recording solutions, or temperature can significantly impact electrophysiological measurements .

  • Allelic Expression Considerations: Differences in allelic expression imbalance between species or experimental systems may affect the apparent dominance of mutations .

  • Resolution Approaches: When faced with contradictory findings, researchers should:

    • Perform side-by-side comparisons using identical experimental conditions

    • Verify protein expression levels and localization

    • Consider differences in post-translational modifications between species

    • Evaluate the influence of other CaCCs in the experimental system

What are the key considerations for designing rescue experiments with recombinant pig BEST1?

Based on human BEST1 research, several important factors should guide the design of rescue experiments with recombinant pig BEST1:

  • Mutation Classification: First determine whether the mutation is loss-of-function or gain-of-function, as this fundamentally affects the rescue strategy :

    • Loss-of-function mutations can typically be rescued by gene augmentation alone

    • Gain-of-function mutations require both silencing of the mutant protein and augmentation with wild-type protein

  • Expression Ratio Optimization: The ratio of mutant to wild-type protein significantly impacts rescue efficiency. For loss-of-function mutations, higher wild-type:mutant ratios may be necessary for effective rescue .

  • Delivery System Selection: For in vitro studies, baculovirus vectors have proven effective for both BEST1 expression and CRISPR/Cas9 delivery .

  • Functional Readout Selection: Ca²⁺-dependent Cl⁻ currents at varying intracellular Ca²⁺ concentrations provide the most direct measure of rescue efficacy. Current measurements at 1.2 μM [Ca²⁺]ᵢ have been particularly informative in human BEST1 studies .

  • Controls and Verification: Essential controls include:

    • Verification of knockdown efficiency for endogenous or mutant BEST1

    • Confirmation of wild-type BEST1 expression levels

    • Comparison to wild-type and untreated mutant controls

    • Measurements at multiple Ca²⁺ concentrations to fully characterize channel function

How can researchers differentiate between primary effects of BEST1 mutations and secondary cellular responses?

Distinguishing direct effects of BEST1 mutations from downstream cellular adaptations requires careful experimental design:

  • Acute vs. Chronic Expression Systems:

    • Transient expression systems (e.g., HEK293 cells) reveal immediate effects of mutations on channel function

    • Stable cell lines or patient-derived iPSC-RPE cells may show both primary effects and secondary adaptations

  • Time-Course Experiments: Monitoring changes in channel function, protein localization, and cellular phenotypes over time can help separate immediate from delayed effects .

  • Molecular Pathway Analysis: Examine changes in:

    • Calcium homeostasis mechanisms

    • Cell volume regulation pathways

    • Transcriptional responses to altered chloride conductance

    • Protein trafficking and degradation pathways

  • Rescue Timing Considerations: The success of rescue interventions may depend on timing relative to disease progression, particularly for distinguishing between developmental defects and ongoing functional requirements .

  • Biomarker Identification: Identify specific markers that correlate with primary BEST1 dysfunction versus secondary degenerative processes to better track disease progression and therapeutic efficacy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.