Recombinant Pig Beta-1 adrenergic receptor (ADRB1)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Production

Recombinant pig ADRB1 is typically produced using in vitro Escherichia coli (E. coli) expression systems, which provide efficient production of the full-length protein . The production in bacterial systems allows for scalable synthesis of the receptor protein, though challenges can exist with proper folding of membrane proteins. The addition of an N-terminal His-tag facilitates purification through affinity chromatography and enables detection in experimental applications .

This production method differs from expression systems used for other species' adrenergic receptors. For instance, when comparing to recombinant turkey (Meleagris gallopavo) Beta-1 adrenergic receptor, similar E. coli expression systems are employed, though the sequence length and specific tags may differ to optimize for species-specific characteristics .

Comparative Tissue Distribution

Pig ADRB1 exhibits a distinctive tissue distribution pattern that has been quantitatively analyzed across various porcine tissues. Research has demonstrated that β1-adrenergic receptors (β1AR) are the predominant β-adrenergic receptor subtype in most pig tissues, with a characteristic distribution profile .

The proportion of β1AR to β2AR varies among tissues, with research indicating an 81:19 ratio in porcine adipocytes . This predominance of β1AR in pig tissues represents an important species-specific characteristic that distinguishes porcine adrenergic signaling from other mammalian models.

The density of β-adrenergic receptors also varies significantly across pig tissues, following a pattern of relative abundance: heart = lung > adipocytes > skeletal muscle ≥ liver . This distribution pattern correlates closely with mRNA abundance data, suggesting that receptor protein levels follow transcriptional patterns across different tissues .

Table 1: Distribution of β-Adrenergic Receptor Subtypes in Pig Tissues

Tissueβ1AR Proportion (%)β2AR Proportion (%)Relative Density
Adipocytes8119High
HeartPredominantMinorVery High
LungPredominantMinorVery High
Skeletal MusclePredominantMinorModerate
LiverPredominantMinorLow-Moderate

This distribution pattern provides important insights for researchers working with recombinant pig ADRB1, particularly when designing experiments that target specific tissue responses or when developing tissue-specific applications .

Signaling Mechanisms

Beta-1 adrenergic receptors in cardiomyocytes primarily couple to Gs proteins to promote the production of cyclic adenosine monophosphate (cAMP) as a second messenger . This signaling cascade leads to activation of exchange protein directly activated by cAMP and protein kinase A (PKA), which subsequently phosphorylates key regulators of cardiac excitation/contraction machinery .

The signaling mechanisms of β1AR in pig tissues appear to be similar to those observed in other species, though with some distinct characteristics. Unlike β2AR, which can couple to both Gs and Gi in several animal species, pig β1AR predominantly signals through Gs pathways . This signaling specificity makes recombinant pig ADRB1 a valuable tool for studying adrenergic pathways in isolation from competing signaling mechanisms.

ELISA-Based Detection

Enzyme-linked immunosorbent assay (ELISA) represents a primary method for the detection and quantification of pig ADRB1 in various biological samples. Commercially available immunoassay kits allow for the in vitro quantitative determination of pig Beta-1 adrenergic receptor concentrations in serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids .

The sandwich ELISA format is typically employed for pig ADRB1 detection, offering sensitive quantification with detection ranges of 0.156-10 ng/mL and minimum detection limits of approximately 0.156 ng/mL . These assays provide specific recognition of recombinant and natural pig Beta-1 adrenergic receptor with minimal cross-reactivity with other proteins .

Standard ELISA kits for pig ADRB1 typically include:

  • Pre-coated assay plates

  • Standards for calibration

  • Sample diluents and assay reagents

  • Detection reagents

  • Wash buffers and substrate solutions

  • Stop solutions and plate sealers

These detection methods are essential for researchers working with recombinant pig ADRB1, particularly for validating expression levels, confirming protein purity, or quantifying receptor concentrations in experimental samples.

Competitive Binding Assays

Beyond ELISA-based detection, competitive binding assays provide another approach for studying recombinant pig ADRB1. These assays typically employ subtype-selective ligands such as CGP 20712A (β1AR-selective antagonist) and BRL 37344 (β2AR-selective ligand) to perform competitive displacement of ligand binding .

Multiple experimental approaches can be used to estimate the distribution of βAR subtypes:

  1. Simultaneous linear regression analysis of multiple competitive displacement curves

  2. Radioligand saturation assays using selective antagonists

  3. Direct binding measurements with labeled selective ligands

These methods complement ELISA-based detection by providing functional insights into receptor binding properties rather than simply quantifying protein abundance.

Cardiovascular Research

Recombinant pig ADRB1 serves as a valuable tool in cardiovascular research, particularly given the predominance of β1AR in pig heart tissue . This mirrors the distribution found in other species, including humans, making pig models relevant for translational cardiovascular studies.

The availability of purified recombinant pig ADRB1 enables detailed investigation of:

  • Receptor-ligand interactions with potential therapeutic compounds

  • Structure-function relationships in β-adrenergic signaling

  • Species-specific differences in receptor pharmacology

  • Molecular mechanisms underlying cardiovascular disease states

Research has shown that βAR internalization represents a pathological process in heart failure, with failing hearts displaying increased GRK2-associated PI3K activity and enhanced sequestration of β1AR into endosomal compartments . Recombinant pig ADRB1 provides a tool for investigating these trafficking mechanisms in controlled experimental settings.

Agricultural and Metabolic Research

Given the significant expression of ADRB1 in pig adipocytes, recombinant pig ADRB1 also has applications in agricultural and metabolic research. The 81:19 ratio of β1AR to β2AR in porcine adipocytes suggests that β1-selective compounds would have predominant effects on adipose metabolism in pigs .

This distribution pattern differs from some other species, highlighting the importance of species-specific research tools like recombinant pig ADRB1 for accurate modeling of metabolic processes in porcine systems. Researchers investigating feed efficiency, muscle growth, or fat deposition in pigs may utilize recombinant ADRB1 to study receptor-mediated effects on these economically important traits.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your desired format when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-468
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVPASPPASLLTPASEGSVQLSQQWTAG MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRAARALVCT VWAISALVSFLPILMHWWRDKGAEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMA FVYLRVFREAQKQVKKIDSCERRFLGSPARPPSPAPSPGSPLPAAAAAAPVANGRTSKRR PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS AFNPIIYCRSPDFRKAFQRLLCCARRVARGSCAAAGDGPRASGCLAVARPPPSPGAASDD DDDEEDVGAAPPAPLLEPWAGYNGGAARDSDSSLDERTPGGRASESKV
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. It mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling and is involved in regulating sleep/wake behaviors.
Gene References Into Functions
  1. Beta(1)- and beta(2)-adrenoceptors contribute to the beta-feedforward coronary resistance vessel dilation during exercise. PMID: 20035031
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.

Q&A

What is Beta-1 adrenergic receptor (ADRB1) and what are its functional properties in porcine models?

Beta-1 adrenergic receptor (ADRB1) is a G-protein-coupled receptor that mediates catecholamine-induced activation of adenylate cyclase, leading to increased cAMP production and subsequent signaling cascades . In porcine systems, ADRB1 plays critical roles in cardiovascular function, metabolic regulation, and potentially sleep-wake cycles, similar to findings in other mammalian species . The receptor is primarily expressed in cardiac tissue, with significant presence also detected in specific brain regions and other tissues.

ADRB1 functions through binding of catecholamines (primarily norepinephrine and epinephrine), which triggers a conformational change in the receptor. This activation traditionally leads to coupling with Gs proteins and stimulation of adenylate cyclase. Recent research has also identified novel signaling pathways for beta-1 adrenergic receptors, including direct binding to the PDZ domain of the cAMP-dependent Ras exchange factor (CNrasGEF), which facilitates Ras activation independently of the canonical G-protein pathway . This mechanism represents an important consideration for researchers studying ADRB1 signaling in various model systems.

What expression systems are most effective for producing functional recombinant porcine ADRB1?

The choice of expression system for recombinant porcine ADRB1 depends significantly on the intended application and which receptor domains are required. Three primary approaches have demonstrated success:

Prokaryotic Expression Systems:

  • E. coli-based expression is effective primarily for producing receptor fragments rather than full-length functional protein

  • This approach works well for the C-terminal domain (residues 378-477 in human ADRB1) and can be enhanced with solubility tags such as His and TrxA

  • Advantages include high yield and cost-effectiveness, though membrane proteins frequently misfold in bacterial systems

Mammalian Expression Systems:

  • HEK293 or CHO cells provide the most native-like environment for proper folding, post-translational modifications, and trafficking

  • These systems are preferred for functional studies requiring intact signaling capabilities

  • Expression levels are typically lower than prokaryotic systems but protein quality is superior

Insect Cell Systems:

  • Sf9 or Sf21 cells offer a compromise with improved folding compared to bacteria and higher yields than mammalian cells

  • Baculovirus expression systems are particularly useful for structural biology applications

For most functional studies examining signaling properties, mammalian expression systems are recommended despite lower yields, as they provide the appropriate cellular machinery for correct folding and post-translational modifications essential for receptor function.

What are the key structural and functional differences between porcine and human ADRB1?

Understanding the comparative biology of porcine and human ADRB1 is essential for translational research. Key similarities and differences include:

Sequence homology:

  • Porcine ADRB1 shares approximately 85-90% amino acid sequence identity with human ADRB1

  • The transmembrane domains show highest conservation (>95%), while the N-terminal and C-terminal regions display greater variability

Ligand binding properties:

  • The orthosteric binding pocket for catecholamines is highly conserved between species

  • Subtle differences in extracellular loop regions may influence the binding kinetics of certain synthetic ligands

  • Most beta-blockers and agonists developed for human ADRB1 maintain similar affinities for porcine ADRB1

Signaling characteristics:

  • Both receptors primarily couple to Gαs proteins, leading to cAMP production

  • The C-terminal PDZ-binding motif that interacts with CNrasGEF in human ADRB1 is preserved in porcine ADRB1, suggesting conservation of this direct Ras-activation pathway

  • The regulatory phosphorylation sites are largely conserved, indicating similar desensitization mechanisms

Physiological considerations:

  • Porcine cardiovascular responses to ADRB1 stimulation closely resemble human responses

  • Recent research on ADRB1's role in sleep regulation identified in human studies might have parallels in porcine models, though specific mutations (like A187V) associated with short sleep phenotypes need verification in porcine genetics

These comparative aspects make porcine ADRB1 a valuable model for translational research, particularly for cardiovascular and neurological applications.

How can researchers effectively study the ADRB1-mediated Ras activation pathway in porcine systems?

The discovery that human beta-1 adrenergic receptor directly binds to CNrasGEF, leading to Ras activation independent of Gβγ subunits, represents an important signaling pathway that warrants investigation in porcine systems . Research approaches should include:

Protein-protein interaction analysis:

  • Co-immunoprecipitation assays to verify the interaction between porcine ADRB1 and CNrasGEF

  • Binding studies with purified components to assess direct interaction

  • Mutation of the C-terminal PDZ-binding motif in porcine ADRB1 to confirm its role in CNrasGEF binding

  • Domain mapping to identify critical interaction regions

Functional signaling analysis:

  • Ras activation assays following isoproterenol stimulation in cells expressing porcine ADRB1

  • Comparison with cells expressing beta-2 adrenergic receptor, which does not activate Ras via CNrasGEF

  • Assessment of the dependence on Gαs versus Gβγ subunits through selective inhibitors or expression of sequestering proteins

  • Evaluation of the requirement for both the catalytic CDC25 domain and cAMP-binding domain of CNrasGEF

Cellular consequence assessment:

  • Downstream signaling to ERK1/2 and other MAPK pathway components

  • Evaluation of cellular responses such as proliferation, hypertrophy, or metabolic changes

  • Comparison between tissues with differential expression of CNrasGEF

This pathway is particularly significant as it represents a direct physical association between a GPCR and a Ras activator, which had not been previously demonstrated prior to the studies with human ADRB1 . Confirming and characterizing this pathway in porcine systems would enhance our understanding of species-specific signaling mechanisms.

What approaches should be used to investigate the role of porcine ADRB1 in sleep regulation?

Recent research has identified that mutations in the human β1-adrenergic receptor gene affect sleep/wake behaviors, specifically linking a mutation (A187V) to natural short sleep phenotypes . To investigate similar pathways in porcine systems:

Genetic and molecular approaches:

  • Sequence analysis of porcine ADRB1 to identify naturally occurring variants

  • In vitro characterization of identified variants for protein stability and signaling response to agonists

  • CRISPR/Cas9-mediated introduction of the A187V equivalent mutation into porcine cell lines or animal models

  • Calcium imaging of ADRB1-positive neurons to assess their activity patterns with wild-type versus mutant receptors

Neuroanatomical characterization:

  • Mapping ADRB1 expression in porcine brain with focus on the dorsal pons, where it shows high expression in rodent models

  • Identification of whether porcine ADRB1-positive neurons in the dorsal pons are primarily glutamatergic or GABAergic, similar to findings in mice

  • Electrophysiological recording to determine if these neurons are active during REM sleep and wakefulness, as observed in mouse models

Sleep phenotyping approaches:

  • EEG/EMG recordings to evaluate sleep architecture in pigs with different ADRB1 variants

  • Activity monitoring to assess mobility time across the 24-hour cycle

  • Analysis of NREM delta power as an indicator of sleep pressure

  • Assessment of recovery sleep following sleep deprivation

Findings from mouse models carrying the A187V mutation demonstrated approximately 55 minutes shorter total sleep time within 24 hours and higher delta power at the beginning of the sleep phase, indicating accumulated sleep pressure . These parameters provide valuable endpoints for comparative studies in porcine models.

What methodologies are recommended for studying post-translational modifications of porcine ADRB1?

Post-translational modifications (PTMs) substantially influence ADRB1 function, trafficking, and signaling properties. For comprehensive characterization:

Phosphorylation analysis:

Glycosylation assessment:

  • Enzymatic deglycosylation with PNGase F (for N-linked) or O-glycosidase (for O-linked) followed by mobility shift analysis

  • Lectin blotting to characterize glycan composition

  • Mutagenesis of predicted N-glycosylation sites (Asn-X-Ser/Thr motifs)

  • Mass spectrometry for detailed glycan profiling

Palmitoylation and lipid modifications:

  • Metabolic labeling with [³H]-palmitate

  • Acyl-biotin exchange chemistry to detect S-palmitoylation

  • Hydroxylamine treatment to cleave thioester bonds

  • Site-directed mutagenesis of conserved cysteine residues in the C-terminal domain

Analytical considerations:

  • Comparison between native tissue-derived and recombinant ADRB1

  • Assessment of modification changes following receptor activation

  • Correlation between modifications and functional properties

  • Subcellular localization studies to determine compartment-specific modifications

The observation that recombinant human ADRB1 fragments show a discrepancy between predicted (30.9 kDa) and actual (34 kDa) molecular mass on SDS-PAGE suggests the presence of PTMs that may affect protein migration . Similar analyses with porcine ADRB1 could provide insights into species-specific modification patterns.

What are the optimal buffer conditions for maintaining stability of recombinant porcine ADRB1?

Maintaining stability of recombinant ADRB1 is critical for functional studies. Recommended buffer conditions include:

For solution stability:

  • Base buffer: PBS (pH 7.4) or Tris-HCl (50 mM, pH 7.4)

  • Salt concentration: 150 mM NaCl (physiological) or higher (200-300 mM) for increased stability

  • Protective agents: 5% Trehalose as a stabilizing excipient

  • Surfactants: 0.01% SKL or similar mild surfactant to prevent aggregation

  • Divalent cations: 1-5 mM MgCl₂ to stabilize nucleotide binding conformation

For membrane-bound receptor:

  • Cholesterol or cholesterol hemisuccinate (CHS) addition (0.1-0.2%) to mimic native membrane environment

  • Glycerol (10-20%) to prevent denaturation

  • Protease inhibitor cocktail to prevent degradation

Storage considerations:

  • Avoid repeated freeze/thaw cycles

  • Store as aliquots at -80°C for long-term storage

  • For working solutions, maintain at 4°C for short periods only

  • Flash-freezing in liquid nitrogen before -80°C storage

Stabilization strategies:

  • Addition of high-affinity ligands (antagonists generally provide better stabilization than agonists)

  • Maintaining protein concentration between 0.1-1.0 mg/mL for optimal stability

  • Avoiding vortexing which can cause denaturation

These conditions provide a starting point, but optimization may be necessary depending on the specific construct and intended application. Buffer composition significantly impacts both structural stability and functional properties of the receptor.

What controls are essential when performing binding studies with recombinant porcine ADRB1?

Rigorous controls are critical for reliable binding studies with recombinant porcine ADRB1:

Essential negative controls:

  • Non-specific binding determination using excess (10-100 μM) non-selective antagonist (propranolol)

  • Vehicle controls matching the solvent composition of test compounds

  • Mock-transfected or untransfected cells to control for endogenous adrenergic receptors

  • Heat-denatured receptor preparation to confirm specificity of binding

Required positive controls:

  • Known β1-selective ligands: CGP 20712A (antagonist) or dobutamine (agonist)

  • Non-selective β-adrenergic ligands: propranolol (antagonist) or isoproterenol (agonist)

  • Human ADRB1 in parallel experiments for species comparisons

  • Saturation binding with a well-characterized radioligand ([³H]CGP-12177 or [¹²⁵I]cyanopindolol)

Selectivity controls:

  • β2-selective antagonist (ICI 118,551) to distinguish β1 from β2 binding

  • Competition with catecholamines (epinephrine, norepinephrine) at different concentrations

  • Receptor subtype-selective compounds to verify receptor identity

Technical validation controls:

  • Protein concentration determination to ensure consistent receptor amounts

  • Time course experiments to confirm binding equilibrium is reached

  • Temperature stability verification through repeated measurements

  • Multiple independent preparations to assess reproducibility

Proper implementation of these controls helps distinguish specific from non-specific binding, verify receptor identity and functionality, and ensure data reliability and reproducibility. The interpretation of binding data should always consider potential influences of the expression system, detergents used for solubilization, and other experimental variables.

What are the recommended approaches for validating functional activity of recombinant porcine ADRB1?

Comprehensive functional validation of recombinant porcine ADRB1 should assess multiple aspects of receptor activity:

cAMP signaling assessment:

  • Dose-response curves with isoproterenol (10⁻¹⁰ to 10⁻⁵ M) measuring cAMP production

  • Comparison of EC₅₀ values with literature data for human ADRB1

  • Antagonist inhibition studies with selective β1-blockers

  • Measurement of basal activity in the absence of agonist stimulation

G-protein coupling evaluation:

  • [³⁵S]GTPγS binding assays to directly measure G-protein activation

  • BRET-based assays monitoring conformational changes in G-proteins

  • Competition between GTP and GDP binding as a measure of receptor-mediated nucleotide exchange

Ras pathway activation:

  • Assessment of Ras activation following isoproterenol stimulation

  • Verification that activation occurs through direct CNrasGEF interaction

  • Comparison with beta-2 adrenergic receptor, which should not activate this pathway

  • Demonstration that activation depends on the PDZ-binding motif of ADRB1

Downstream signaling cascades:

  • ERK1/2 phosphorylation in response to receptor activation

  • PKA substrate phosphorylation (e.g., CREB, cardiac troponin I)

  • Calcium mobilization via alternative pathways

  • Receptor desensitization and internalization kinetics

The validation should confirm that recombinant porcine ADRB1 responds to isoproterenol stimulation with appropriate signaling outputs, including both canonical (G-protein/cAMP) and non-canonical (CNrasGEF/Ras) pathways . Comparisons with human ADRB1 can provide valuable insights into species-specific functional characteristics.

What methodological approaches are recommended for studying ADRB1 mutations that affect sleep regulation?

The identification of mutations in the human ADRB1 gene associated with natural short sleep phenotypes provides a framework for studying similar mechanisms in porcine models:

In vitro functional characterization:

  • Protein stability analysis comparing wild-type and mutant receptors

  • cAMP signaling assays to assess changes in response to agonist treatment

  • Calcium imaging to evaluate neuronal activity patterns

  • Electrophysiological recording of neurons expressing wild-type vs. mutant receptors

Cellular localization studies:

  • Expression mapping in dorsal pons and other sleep-regulating brain regions

  • Co-localization with neuronal markers (glutamatergic, GABAergic, cholinergic)

  • Trafficking analysis to assess surface expression levels

  • Protein-protein interaction studies to identify altered binding partners

Animal model development:

  • CRISPR/Cas9-mediated introduction of equivalent mutations (e.g., A187V) in porcine models

  • EEG/EMG recording for sleep phenotyping (total sleep time, NREM/REM duration)

  • Activity monitoring to assess wake time and mobility patterns

  • Delta power analysis during NREM sleep to evaluate sleep pressure

Data analysis methods:

  • Automated sleep staging algorithms for continuous long-term recording

  • Frequency analysis of EEG data across sleep states

  • Comparison of sleep architecture parameters (bout number, bout duration)

  • Correlation between calcium imaging data and EEG/EMG-defined sleep states

Research with mouse models carrying the A187V mutation demonstrated reduced total sleep time (approximately 55 minutes less over 24 hours), primarily due to reduction in NREM sleep during the dark phase . Similar phenotyping approaches would be valuable for porcine models with equivalent mutations.

What techniques are most effective for studying porcine ADRB1 interaction with CNrasGEF?

The direct interaction between beta-1 adrenergic receptor and CNrasGEF represents a novel signaling pathway that merits detailed investigation in porcine systems :

Protein-protein interaction methods:

  • Co-immunoprecipitation to verify physical association in cell systems

  • GST pull-down assays using the PDZ domain of CNrasGEF and C-terminal peptides of porcine ADRB1

  • Surface plasmon resonance to measure binding kinetics and affinity

  • FRET/BRET approaches for real-time monitoring of interactions in living cells

Structural approaches:

  • Mutation of the C-terminal PDZ-binding motif (SkV in human ADRB1)

  • Peptide competition assays using synthetic C-terminal peptides

  • Domain deletion studies to identify minimal binding regions

  • Molecular modeling and docking simulations

Functional validation:

  • Ras activation assays following isoproterenol stimulation

  • Comparison between wild-type ADRB1 and mutants that cannot bind CNrasGEF

  • Assessment of CNrasGEF mutants lacking catalytic CDC25 or cAMP-binding domains

  • Evaluation of signaling through Gαs versus Gβγ pathways

Cellular localization studies:

  • Co-localization analysis of ADRB1 and CNrasGEF

  • Membrane fractionation to determine interaction compartments

  • Single-molecule tracking to assess dynamic assembly of signaling complexes

  • Proximity ligation assays for in situ visualization of the interaction

Based on findings with human proteins, it would be important to verify that porcine ADRB1 interacts with CNrasGEF via its C-terminal PDZ-binding motif, that this interaction facilitates isoproterenol-induced Ras activation, and that the activation is mediated by Gαs rather than Gβγ .

What methodological considerations are important when optimizing recombinant porcine ADRB1 expression?

Optimizing expression of recombinant porcine ADRB1 requires attention to several key factors:

Vector design considerations:

  • Codon optimization for the expression host

  • Addition of appropriate fusion tags (His, FLAG, TrxA) for purification and detection

  • Inclusion of optimal signal sequences for membrane targeting

  • Promoter selection based on expression host (e.g., T7 for E. coli, CMV for mammalian cells)

Host system selection:

  • E. coli for truncated domains (as used for human ADRB1 C378-V477)

  • Mammalian cells (HEK293, CHO) for full-length functional studies

  • Insect cells for structural biology applications

  • Cell-free systems for rapid screening of constructs

Expression conditions:

  • Temperature optimization (often reduced to 16-18°C for membrane proteins)

  • Induction parameters (concentration, timing, duration)

  • Media composition and supplements

  • Cell density at induction time

Stabilization strategies:

  • Co-expression with ligands or binding partners

  • Addition of chaperones to improve folding

  • Cholesterol supplementation for membrane proteins

  • Fusion with stability-enhancing proteins

Purification optimization:

  • Detergent selection for solubilization (DDM, LMNG, digitonin)

  • Buffer composition (pH, salt concentration, additives)

  • Purification temperature (typically 4°C)

  • Elution conditions to maintain functionality

The detailed properties provided for recombinant human ADRB1 (purity >85%, pH 7.4 buffer containing 0.01% SKL and 5% Trehalose) offer a valuable starting point for developing production protocols for the porcine homolog, particularly for truncated versions of the receptor.

What experimental strategies can distinguish between canonical and non-canonical signaling pathways of porcine ADRB1?

Beta-1 adrenergic receptors signal through both canonical (G-protein/cAMP) and non-canonical (e.g., CNrasGEF/Ras) pathways . To distinguish between these:

Pathway-specific inhibitors:

  • PKA inhibitors (H-89, KT5720) to block canonical cAMP/PKA signaling

  • Dominant-negative Ras constructs to inhibit Ras signaling

  • Pertussis toxin to inactivate Gi/o proteins

  • Cholera toxin to constitutively activate Gs proteins

Mutational approaches:

  • Receptor mutations that selectively impair G-protein coupling

  • C-terminal truncations to eliminate PDZ-binding motif required for CNrasGEF interaction

  • Targeted mutations in the CNrasGEF binding interface

  • Point mutations in the catalytic CDC25 domain of CNrasGEF

Pathway-specific readouts:

  • FRET-based cAMP sensors for canonical pathway

  • Ras-GTP pull-down assays for CNrasGEF pathway

  • Phospho-specific antibodies for downstream kinase activation

  • Transcriptional reporters for pathway-specific gene expression

Temporal resolution studies:

  • Kinetic analysis of pathway activation (G-protein coupling occurs within seconds, while Ras activation may have different kinetics)

  • Desensitization patterns for different pathways

  • Recovery kinetics following withdrawal of stimulus

  • Persistent signaling analysis after receptor internalization

Biased ligand approach:

  • Screening ligands that preferentially activate one pathway over another

  • Correlation between binding affinity and pathway efficacy

  • Structure-activity relationship studies to identify pathway-selective regions of ligands

  • Development of allosteric modulators that bias signaling

These approaches can reveal whether the CNrasGEF/Ras pathway activation observed with human ADRB1 is conserved in porcine ADRB1, and how this non-canonical pathway interacts with traditional G-protein signaling.

What are the critical quality control parameters for recombinant porcine ADRB1?

Ensuring the quality of recombinant porcine ADRB1 preparations requires systematic assessment of multiple parameters:

Purity assessment:

  • SDS-PAGE with Coomassie staining (target >85% purity)

  • Western blotting with receptor-specific antibodies

  • Mass spectrometry to identify potential contaminants

  • Size exclusion chromatography to evaluate homogeneity

Identity verification:

  • Peptide mass fingerprinting

  • N-terminal sequencing

  • Immunoreactivity with subtype-specific antibodies

  • Molecular weight confirmation (accounting for tags and post-translational modifications)

Structural integrity:

  • Circular dichroism to assess secondary structure

  • Intrinsic tryptophan fluorescence for tertiary structure evaluation

  • Thermal stability measurements (e.g., differential scanning fluorimetry)

  • Limited proteolysis to probe folding state

Functional validation:

  • Ligand binding assays with known agonists and antagonists

  • G-protein coupling efficiency

  • cAMP production in response to isoproterenol

  • Ras activation through the CNrasGEF pathway

Stability monitoring:

  • Activity retention during storage at different temperatures

  • Freeze-thaw tolerance assessment

  • Aggregation monitoring by dynamic light scattering

  • Long-term stability under recommended storage conditions

For truncated versions, such as those including only the C-terminal domain (residues 378-477 in human ADRB1), a difference between predicted (30.9 kDa) and observed (34 kDa) molecular mass on SDS-PAGE may be expected due to the influence of tags or post-translational modifications . Similar considerations would apply to porcine ADRB1 fragments.

What approaches are recommended for studying the role of porcine ADRB1 in neural circuits regulating sleep?

Research on ADRB1's role in sleep regulation requires integrating multiple methodological approaches:

Neural circuit mapping:

  • In situ hybridization to identify ADRB1-expressing neurons

  • Retrograde and anterograde tracing to map connections of ADRB1+ neurons

  • TRAP (Translating Ribosome Affinity Purification) for molecular profiling of ADRB1+ neurons

  • Single-cell RNA sequencing to characterize cell populations

Activity monitoring:

  • Fiber photometry to record calcium signals from ADRB1+ neurons during sleep-wake transitions

  • EEG/EMG recording for sleep stage classification

  • Correlation between neuronal activity and specific sleep phases

  • Comparison between wild-type and mutant (e.g., A187V equivalent) ADRB1

Circuit manipulation:

  • Optogenetic activation/inhibition of ADRB1+ neurons in specific brain regions

  • Chemogenetic approaches for sustained modulation of neuronal activity

  • Pharmacological manipulation with selective β1-agonists and antagonists

  • Targeted genetic manipulation using Cre-dependent viral vectors in ADRB1-Cre animals

Physiological analysis:

  • Assessment of sleep architecture (NREM/REM duration, bout number)

  • Delta power analysis during NREM sleep

  • Recovery sleep following sleep deprivation

  • Correlation between ADRB1 signaling and homeostatic sleep regulation

Research in mice has shown that ADRB1+ neurons in the dorsal pons are active during both REM sleep and wakefulness, and that the A187V mutation affects this activity pattern . Similar approaches in porcine models could provide valuable insights into conserved mechanisms of sleep regulation across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.