Recombinant Pig Blood vessel epicardial substance (BVES)

Shipped with Ice Packs
In Stock

Description

Introduction

Blood Vessel Epicardial Substance (BVES), also known as POPDC1 (Popeye Domain Containing 1) or POP1, is a protein crucial in developing various tissues . BVES is expressed in cardiac and skeletal muscle and throughout the gastrointestinal epithelium . It functions as a cell adhesion molecule and is involved in maintaining tissue integrity and suppressing tumorigenesis . The recombinant form of pig BVES is produced for research purposes, allowing scientists to study its function and potential therapeutic applications in a controlled environment .

General Information

CharacteristicDescription
Full NameBlood vessel epicardial substance
SynonymsBVES; POP1; POPDC1; Popeye domain-containing protein 1; Popeye protein 1
Gene NameBVES
SpeciesSus scrofa (Pig)
SourceE. coli
TagHis-tagged
Protein LengthFull Length (1-360 amino acids)
AA SequenceMNYTESSPLAESTAIGFTPELGSITPVPSNETTCENWREIHHLVFHVANVFFAIGLVLPTTLHLHMILLRGMLTIGCTLYIVWATLYRCALDIMIWNSVFLGINVLHLSYLLYKKRPVKIEKELKGIYQRLFEPLRVPPDLFKRLTGQFCMIQTLKKGQAYAAEDKTSVDDRLSILLKGK MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEVFRYLIGKDITNKLYSLNDPTLNDKTIKKLDHQLSLCTQLSMLEMRNSIVSTSDSEDGLHQFLRGTSSVSSLYVPSPHQRASAKMKPIEEGVEDDDEVFEPETPNTFKVRQLP
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage
UniProt IDB8Q0B2

Production and Characteristics of Recombinant Pig BVES

Recombinant pig BVES is typically produced in E. coli and tagged with histidine (His) to facilitate purification . The protein consists of 360 amino acids and has a high purity level (greater than 90%) . The recombinant protein is stored as a lyophilized powder in a Tris/PBS-based buffer with trehalose to maintain stability . Researchers can reconstitute the protein in sterile water for experimental use .

Function and Significance

BVES, a member of the POP family of proteins, contains three putative transmembrane domains . It plays a crucial role in various cellular processes:

  • Cell Adhesion: BVES functions as a cell adhesion molecule, which is essential for maintaining tissue structure and integrity .

  • Cardiac Pacemaking: BVES is involved in cardiac pacemaking by modulating the affinity of cAMP interaction and interacting with the 2-pore domain potassium channel TREK-1 .

  • Epithelial Integrity: BVES regulates epidermal tight junction integrity . Mice lacking BVES exhibit worse intestinal injury and inflammation, indicating its role in preserving epithelial phenotypes .

  • Tumor Suppression: BVES is suppressed in gastrointestinal cancers, and its loss promotes tumor formation. BVES can regulate molecular pathways, including cAMP, WNT, and promoting the degradation of the oncogene, c-Myc .

Research Applications

Recombinant pig BVES is a valuable tool for various research applications:

  • Protein Structure and Function Studies: Researchers use recombinant BVES to study the protein's structure, interactions, and functions in vitro .

  • Drug Discovery: Recombinant BVES can screen potential therapeutic compounds that modulate BVES activity and target related diseases .

  • Cell Signaling Pathways: Recombinant BVES is employed to investigate BVES-related cell signaling pathways and their roles in different physiological and pathological conditions .

  • Understanding Disease Mechanisms: Studies using recombinant BVES can help elucidate the mechanisms underlying diseases related to BVES dysfunction, such as cancer and cardiovascular diseases .

Role in Cardiovascular Function

BVES plays a significant role in cardiovascular function, particularly in cardiac pacemaking . Studies have identified a high-affinity cAMP binding domain within the POPEYE domain of BVES, which interacts with the 2-pore domain potassium channel TREK-1 . This interaction is sensitive to cAMP stimulation, suggesting that BVES recruits TREK-1 to the membrane to enhance current, modulated by cAMP levels . BVES knockout mice have impaired stress-induced bradycardia, indicating a sinus node defect .

BVES in Cancer Research

BVES is recognized as a tumor suppressor in gastrointestinal cancers . Its expression is often suppressed in cancerous tissues, and the loss of BVES promotes tumor formation . BVES regulates several molecular pathways, including promoting the degradation of the oncogene c-Myc .

BVES and Enterovirus

Research has identified recombinant enterovirus G (EV-G) viruses in pigs . Type 2 recombinant EV-Gs, which carry the torovirus PLCP gene, have been detected in pig farms . These viruses can undergo sequence changes over time due to persistent infection within pig farms or circulation between farms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BVES; POP1; POPDC1; Blood vessel epicardial substance; Popeye domain-containing protein 1; Popeye protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
BVES
Target Protein Sequence
MNYTESSPLAESTAIGFTPELGSITPVPSNETTCENWREIHHLVFHVANVFFAIGLVLPT TLHLHMILLRGMLTIGCTLYIVWATLYRCALDIMIWNSVFLGINVLHLSYLLYKKRPVKI EKELKGIYQRLFEPLRVPPDLFKRLTGQFCMIQTLKKGQAYAAEDKTSVDDRLSILLKGK MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE SEPFLYEVFRYLIGKDITNKLYSLNDPTLNDKTIKKLDHQLSLCTQLSMLEMRNSIVSTS DSEDGLHQFLRGTSSVSSLYVPSPHQRASAKMKPIEEGVEDDDEVFEPETPNTFKVRQLP
Uniprot No.

Target Background

Function

Recombinant Pig Blood Vessel Epicardial Substance (BVES) is a cell adhesion molecule crucial for maintaining cell integrity. It plays a vital role in forming and regulating the tight junction (TJ) paracellular permeability barrier in epithelial cells. Further, BVES is involved in VAMP3-mediated vesicular transport and receptor recycling through its interaction with VAMP3. It modulates cell shape and movement by influencing Rho-family GTPase activity via interaction with ARHGEF25/GEFT, inducing initial cell adhesion and aggregation independently of calcium. BVES is essential for skeletal muscle and heart development, contributing to striated muscle regeneration and repair and regulating cell spreading. Its role in maintaining cardiac function is significant, influencing heart rate dynamics potentially through cAMP binding and increased cell surface expression of the potassium channel KCNK2. Moreover, as a caveolae-associated protein, BVES is important for preserving caveolae structure and function, protecting the heart against ischemic injury.

Database Links

KEGG: ssc:100153106

UniGene: Ssc.20392

Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.