Recombinant Pig C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig C-X-C Chemokine Receptor Type 4 (CXCR4)

Recombinant Pig C-X-C chemokine receptor type 4 (CXCR4) is a laboratory-engineered version of the transmembrane G protein-coupled receptor (GPCR) expressed in pigs (Sus scrofa). CXCR4 binds its primary ligand, CXCL12 (stromal cell-derived factor-1), to regulate intracellular calcium levels, MAPK signaling, and cellular migration . It plays critical roles in hematopoiesis, cardiac development, immune response, and viral entry mechanisms . Recombinant forms are widely used in biomedical research to study receptor-ligand interactions, disease mechanisms, and therapeutic targeting.

Production and Purification

Recombinant pig CXCR4 is produced using heterologous expression systems:

ParameterSpecification
Host SystemsE. coli, yeast (Pichia pastoris), mammalian cells (HEK-293T)
Purity≥85% (verified by SDS-PAGE)
ReconstitutionLyophilized protein reconstituted in sterile water with 5–50% glycerol
Storage-20°C/-80°C (lyophilized form stable for 12 months)
TaggingEpitope tags (FLAG, V5) for detection and purification

Yeast-derived recombinant CXCR4 retains native conformation, enabling functional studies like ligand binding and antibody development .

Key Assays

Assay TypeDetails
ELISASensitivity: 0.058 ng/mL; Range: 0.156–10 ng/mL (sandwich format)
Calcium FluxMeasures intracellular Ca²⁺ mobilization post-CXCL12 stimulation
HIV-1 InhibitionIC₅₀ values: 5 nM (IT1t) to 435 nM (BTK-140) for blocking viral entry
Cell MigrationIC₅₀: 60 nM (AMD3100) in SupT1 cell chemotaxis assays

Research Applications

  • Immunology: Studying monocyte recruitment in atherosclerosis via endothelial CXCR4 .

  • Virology: Investigating HIV-1/2 co-receptor mechanisms .

  • Reproductive Biology: Maternal CXCR4 knockout models show placental defects and pregnancy loss .

  • Cancer: Role in metastasis via CXCL12-driven chemotaxis .

Key Research Findings

  1. Placental Development: Global deletion of maternal CXCR4 in mice increases pregnancy resorption rates (46.7% vs. 8.3% in controls) .

  2. Atherosclerosis: Endothelial CXCR4 expression correlates with plaque inflammation and monocyte recruitment, detectable via PET tracers .

  3. HIV Entry: Small-molecule antagonists (e.g., AMD3100) block viral fusion by targeting CXCR4’s extracellular loops .

  4. Structural Insights: Mutagenesis studies identified 41 residues critical for CXCL12-induced signaling, including transmembrane helices III and VII .

Technical Considerations

ParameterSpecification
UniProt IDQ764M9
Detection Antibodies12G5 (conformational epitope), anti-FLAG M2
Cross-ReactivityReacts with natural and recombinant pig CXCR4; no cross-reactivity with bovine/mouse
StabilityRetains activity for 6–12 months under recommended storage

Challenges and Future Directions

  • Expression Challenges: Low yields in E. coli due to misfolding; mammalian systems preferred for post-translational modifications .

  • Therapeutic Targeting: Developing CXCR4 inhibitors with reduced off-target effects (e.g., cardiovascular toxicity) .

  • Imaging Applications: Optimizing CXCR4-specific PET tracers for clinical diagnostics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MDGFRIFTSDNYTEDDLGSGDYDSIKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN LYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVRE GDGRYICDRFYPNDLWLVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK TTVILILAFFACWLPYYIGISIDSFILLEIIQQGCEFESTVHKWISITEALAFFHCCLNP ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
CXCR4 is a receptor for the C-X-C chemokine CXCL12/SDF-1. It transduces signals by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. CXCR4 is involved in the AKT signaling cascade and plays a role in regulating cell migration, for instance, during wound healing. It acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. CXCR4 binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. It is implicated in hematopoiesis and cardiac ventricular septum formation. CXCR4 also plays a crucial role in the vascularization of the gastrointestinal tract, likely by regulating vascular branching or remodeling processes in endothelial cells. It is involved in cerebellar development. In the CNS, CXCR4 could mediate hippocampal-neuron survival.
Gene References Into Functions
  1. CXCR4 controls leukocyte mobilization after trauma. PMID: 22634721
  2. A new method has shown to be capable of promoting CSCs proliferation and differentiation into cardiomyocytes through activating the SDF-1/CXCR4 axis, while inhibiting myocardial apoptosis, thereby enhancing myocardial regeneration. PMID: 22146760
  3. Research reports transmural and perivascular expression patterns of chemokines CCL2 and CXCL2 and of chemokine receptors CCR2, CCR5, and CXCR4 following coronary angioplasty PMID: 16926016
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Q&A

What is the structure and function of pig CXCR4?

Pig CXCR4 (also known as CD184, Fusin, LESTR, among other names) is a seven-transmembrane G protein-coupled receptor that functions as a receptor for chemokines, particularly CXCL12 (SDF-1α). The receptor consists of an N-terminal domain, seven transmembrane domains, three extracellular loops, and three intracellular loops followed by a C-terminal tail. Structurally, pig CXCR4 shares significant homology with human CXCR4, particularly in the transmembrane domains and ligand-binding regions. Functionally, CXCR4 mediates the homing and retention of stem cells in bone marrow through its interaction with CXCL12 and plays critical roles in organogenesis, tissue repair, inflammation, and potentially in cancer metastasis .

The receptor's activation triggers various downstream signaling pathways, including calcium mobilization, chemotaxis, and cell survival pathways. The interaction between CXCR4 and its ligands can be detected through functional assays such as calcium mobilization assays, where agonist binding leads to a measurable calcium flux, as demonstrated in studies with TFF2 activation of CXCR4 .

How can pig CXCR4 expression be detected in tissue samples?

Pig CXCR4 expression can be detected through several complementary methods depending on the research question:

ELISA-based detection: Sandwich enzyme immunoassay is a reliable method for quantifying CXCR4 in tissue homogenates and biological fluids. Commercial kits for pig CXCR4 typically have detection ranges of 0.16-10 ng/mL with sensitivities of approximately 0.059 ng/mL . The assay principle involves antibody capture of CXCR4, followed by detection with biotin-conjugated antibodies specific to pig CXCR4, and visualization through HRP-conjugated avidin and TMB substrate reactions.

Flow cytometry: CXCR4 expression on cell surfaces can be detected using fluorescently-labeled antibodies. This technique is particularly useful for analyzing CXCR4 expression on specific cell populations like stem cells. Studies have shown that CXCR4-positive cells can be identified and quantified in peripheral blood after mobilization with CXCR4 antagonists .

Immunohistochemistry: For spatial localization of CXCR4 within tissues, immunohistochemical staining with specific antibodies against pig CXCR4 is valuable. This method preserves tissue architecture and allows visualization of CXCR4 distribution within different cell types and tissue regions.

For all detection methods, proper controls including isotype controls for antibody specificity, positive and negative tissue controls, and careful sample preparation are essential for accurate results.

What cell types in pigs express significant levels of CXCR4?

Multiple porcine cell populations express significant levels of CXCR4, making it an important molecular target for various research applications:

Hematopoietic stem cells (HSCs): CD34+ cells in pig bone marrow and peripheral blood (after mobilization) express CXCR4, which regulates their retention in bone marrow and mobilization into circulation .

Mesenchymal stem cells (MSCs): Studies have demonstrated that porcine MSCs, including CD271-positive MSCs, express CXCR4. These cells can be mobilized from bone marrow using CXCR4 antagonists like TG-0054 . The mobilized MSCs maintain their differentiation potential into adipocytes, osteoblasts, and chondrocytes, making them valuable for potential therapeutic applications.

Endothelial progenitor cells (EPCs): Research has shown that VEGFR2+/CXCR4+ and CD133+/CXCR4+ cells, recognized as EPCs, express CXCR4 and can be mobilized using antagonists such as DBPR807 .

White blood cells: Various leukocyte populations in porcine peripheral blood express CXCR4, which regulates their trafficking during inflammatory responses .

Understanding the expression pattern across these cell types is critical for designing experiments targeting specific cell populations in porcine models of human disease and regeneration.

How can recombinant pig CXCR4 be produced for research applications?

Producing recombinant pig CXCR4 requires special considerations due to its nature as a multi-pass membrane protein. Several expression systems can be employed:

Mammalian cell expression systems: For functional studies requiring proper folding and post-translational modifications, mammalian expression systems are preferred. Cell lines like HEK293 or CHO cells can be transfected with vectors containing the pig CXCR4 gene. The AGS cell line has been successfully used for stable expression of CXCR4-GFP chimeric receptors, suggesting similar approaches could work for pig CXCR4 . The addition of a C-terminal tag (such as GFP or His-tag) facilitates purification and detection without significantly affecting receptor function when properly designed.

Insect cell expression systems: Baculovirus-infected insect cells (Sf9, Sf21, or High Five cells) offer an alternative system that often yields higher protein amounts while maintaining most post-translational modifications.

Cell-free expression systems: For structural studies, cell-free systems using wheat germ extracts or E. coli extracts supplemented with lipids can produce CXCR4 directly into artificial membrane environments.

For purification, detergent solubilization followed by affinity chromatography is typically employed. Critical parameters include:

  • Selection of appropriate detergents (mild detergents like DDM or LMNG)

  • Addition of cholesterol to maintain stability

  • Use of CXCR4 antagonists during purification to stabilize the receptor conformation

The purified receptor should be validated through functional assays such as ligand binding studies or signaling assays to confirm proper folding and activity.

What functional assays can be used to evaluate recombinant pig CXCR4 activity?

Several complementary functional assays can be employed to comprehensively evaluate the activity of recombinant pig CXCR4:

Calcium mobilization assay: This assay measures intracellular calcium flux upon receptor activation. Cells expressing recombinant pig CXCR4 are loaded with calcium-sensing dyes like Indo-1, then stimulated with CXCR4 ligands such as SDF-1α (CXCL12) or TFF2. The resulting calcium flux can be measured by spectrofluorometry. Research shows that CXCR4 activation in Jurkat cells produces a calcium response that can be blocked by receptor desensitization or pretreatment with specific antagonists like AMD3100 .

Chemotaxis assay: This assay evaluates the migratory response of cells expressing CXCR4 toward a gradient of SDF-1α. Using transwell chambers (typically with 5-μm pore size filters), cells expressing recombinant pig CXCR4 are placed in the upper chamber, and SDF-1α (100 ng/ml) is added to the lower chamber. After incubation, the percentage of cells migrating to the lower chamber is quantified. Studies have demonstrated that pre-treatment with CXCR4 antagonists or competitive ligands like TFF2 can inhibit this migration, confirming specificity .

Ligand binding assays: Radioligand binding or fluorescent ligand binding assays using labeled SDF-1α can determine binding affinity (Kd) and receptor density (Bmax). Competition binding with unlabeled ligands or antagonists provides information about binding specificity.

Signaling pathway activation: Western blotting to detect phosphorylation of downstream signaling molecules (ERK1/2, Akt) following ligand stimulation provides information about signaling capacity.

For all assays, appropriate controls including known CXCR4 antagonists (AMD3100), receptor-null cells, and antibody blocking experiments should be included to validate specificity.

How can one assess the mobilization of CXCR4+ stem cells in porcine models?

The assessment of CXCR4+ stem cell mobilization in porcine models requires a multi-parameter approach:

Flow cytometric analysis: The gold standard for quantifying mobilized stem cells involves collecting peripheral blood at defined timepoints after administration of CXCR4 antagonists and analyzing by flow cytometry. Multiple stem cell markers should be assessed:

  • HSC markers: CD34+/CXCR4+

  • MSC markers: CD133+/CXCR4+, CD271+/CXCR4+

  • EPC markers: VEGFR2+/CXCR4+, VEGFR2+/Sca-1+

Research has demonstrated that after administration of CXCR4 antagonists like TG-0054, stem cell numbers in peripheral blood peak at 0.5-1 hour post-administration, with different subpopulations returning to baseline at varying rates (CD34+ cells at 2 hours, CD271+ cells at 6 hours, and CD133+ cells at 24 hours) .

Colony-forming assays: Functional assessment of mobilized stem cells can be performed using colony-forming unit (CFU) assays. Research has shown that plastic-adherent MSCs (PA-MSCs) collected from peripheral blood after TG-0054 administration demonstrate increased colony formation efficiency (CFE) from 0.05 ± 0.02 before treatment to 3.18 ± 0.39 following two doses .

In vivo tracking: For research focusing on stem cell homing to injury sites, labeling mobilized cells with fluorescent dyes or genetic markers and tracking their distribution using imaging techniques provides valuable spatial information.

A comprehensive time course analysis is essential, as different stem cell populations show distinct mobilization kinetics. The experimental design should include appropriate controls and multiple timepoints to capture the complete mobilization profile.

How does pig CXCR4 compare with human CXCR4 in terms of antagonist response and signaling?

Pig and human CXCR4 show important similarities and differences in antagonist response and signaling pathways that must be considered when using porcine models for translational research:

Antagonist sensitivity: Studies have demonstrated that established CXCR4 antagonists effective in human systems, such as AMD3100 (plerixafor), also effectively block pig CXCR4. Similarly, newer antagonists like TG-0054 and DBPR807 have shown efficacy in porcine models . Comparative studies suggest that DBPR807 exhibits more efficient capability than AMD3100 in mobilizing various types of endothelial progenitor cells in mice, which may extend to porcine models .

Signaling pathways: Both pig and human CXCR4 activate similar downstream signaling cascades, including calcium flux, ERK1/2 phosphorylation, and chemotactic responses. Studies have shown that TFF2 peptide can activate signaling via the CXCR4 receptor in both systems, triggering calcium mobilization that can be abrogated by receptor desensitization with SDF-1α or by pretreatment with specific antagonists .

Receptor structure: While the core structure is conserved, subtle differences in extracellular domains may influence ligand binding characteristics. Antibodies recognizing conformation-dependent epitopes in human CXCR4, such as 12G5 (which recognizes amino acid 28 in the NH2 terminus, amino acids 179, 181, 182, and 190 in ECL2, and amino acid 274 in ECL3), may show variable cross-reactivity with pig CXCR4 .

These comparative aspects should be considered when designing experiments in porcine models intended to translate to human applications, particularly in therapeutic development targeting the CXCR4/CXCL12 axis.

What are the challenges in developing stable cell lines expressing recombinant pig CXCR4?

Developing stable cell lines expressing recombinant pig CXCR4 presents several technical challenges that researchers should address through careful experimental design:

Receptor internalization and downregulation: CXCR4 undergoes ligand-induced internalization and downregulation, which can affect stable expression levels. Research has shown that continuous exposure to ligands or constitutive receptor activity can lead to decreased surface expression over time. Strategies to address this include:

  • Using inducible expression systems

  • Creating mutations that reduce constitutive activity while maintaining ligand responsiveness

  • Carefully optimizing culture conditions to minimize autocrine signaling

Toxicity from overexpression: High-level expression of GPCRs like CXCR4 can be toxic to cells due to constitutive activity or ER stress from protein overload. The retroviral construct approach used for CXCR4-GFP expression in AGS cells represents one strategy to achieve controlled, stable expression .

Selection of appropriate host cells: The host cell background can significantly influence CXCR4 expression and function. Ideally, cell lines with minimal endogenous CXCR4 expression should be used. Studies have used CXCR4-negative gastric AGS cells for heterologous expression, providing a clean background for functional studies .

Maintaining functional coupling: Ensuring that recombinant CXCR4 maintains proper coupling to downstream signaling pathways is critical. Functional validation through calcium mobilization assays and chemotaxis assays, as described in research with Jurkat cells, is essential to confirm that the receptor is not just expressed but functionally active .

When developing stable pig CXCR4-expressing cell lines, researchers should implement quality control measures including regular testing for mycoplasma contamination, verification of receptor expression levels over passage number, and periodic functional validation.

How can CXCR4 antagonists be optimized for stem cell mobilization in porcine models?

Optimization of CXCR4 antagonists for stem cell mobilization in porcine models requires systematic evaluation of multiple parameters:

Dosage optimization: Studies have demonstrated that CXCR4 antagonists exhibit dose-dependent effects on stem cell mobilization. For example, with TG-0054, researchers observed increased mobilization of CD34+, CD133+, and CD271+ cells following administration, with peak effects occurring at specific timepoints . Dose-response studies should be conducted to determine:

  • Minimum effective dose

  • Optimal dose for specific stem cell populations

  • Potential ceiling effects at higher doses

  • Duration of effect at different dose levels

Timing and administration schedule: Research has revealed distinct temporal dynamics in stem cell mobilization following CXCR4 antagonist administration. After the first dose of TG-0054, CD34+, CD133+, and CD271+ cells in peripheral blood peaked at 0.5-1 hour, with different subpopulations returning to baseline at varying rates . These findings suggest that:

  • Optimized collection times should be tailored to specific stem cell populations

  • Multiple dosing strategies may be beneficial for sustained mobilization

  • Combined sequential antagonist approaches could potentially enhance yield

Combination with other mobilizing agents: Research indicates that CXCR4 antagonists can be complementary to other mobilization strategies. While G-CSF is commonly used, patients with multiple myeloma and non-Hodgkin lymphoma often show poor mobility in response to G-CSF, and those undergoing chemotherapy may be resistant . Therefore, investigating combinations of CXCR4 antagonists with other agents could yield synergistic effects.

Pharmacokinetic considerations: Development of new CXCR4 antagonists should incorporate pharmacokinetic optimization. For example, half-life extension methods used for conventional antibody fragments, such as PEGylation or fusion to serum albumin, could be applied to nanobodies targeting CXCR4 to increase their therapeutic window .

Comparative studies between different CXCR4 antagonists have shown varying efficacy. For instance, DBPR807 displayed more efficient capability than AMD3100 to mobilize various types of endothelial progenitor cells , suggesting that continued refinement of antagonist structure can lead to improved mobilization efficiency.

How can recombinant pig CXCR4 and its antagonists be utilized in cardiac regeneration research?

Recombinant pig CXCR4 and its antagonists offer substantial potential in cardiac regeneration research, particularly in myocardial infarction (MI) and heart failure models:

Stem cell mobilization for cardiac repair: CXCR4 antagonists have demonstrated effectiveness in mobilizing both hematopoietic and mesenchymal stem cells that can contribute to cardiac repair. In porcine models of post-infarction heart failure, TG-0054 administration mobilized CD34+, CD133+, and CD271+ stem cells into peripheral circulation . These mobilized cells can potentially migrate to damaged myocardium, guided by SDF-1 gradients.

Myocardial SDF-1 expression dynamics: Research has shown that myocardial SDF-1 expression is rapidly upregulated and maintained for approximately one week after MI, creating a chemotactic gradient for CXCR4+ stem cells . This temporal window provides a critical opportunity for intervention with CXCR4 antagonists to maximize stem cell trafficking to damaged tissue.

Therapeutic strategies leveraging CXCR4/SDF-1 axis: Several approaches have demonstrated efficacy in preclinical models:

  • Myocardial injection of exogenous protease-resistant SDF-1

  • Adenovirus-mediated SDF-1 transduction of infarcted myocardium

  • Overexpression of CXCR4 in transplanted MSCs

These strategies have been shown to drive endogenous or transplanted stem cells toward injured myocardium and improve cardiac function .

Anti-inflammatory effects: Beyond stem cell mobilization, CXCR4 antagonists may confer additional benefits through modulation of inflammatory responses. Research has shown that these compounds can alleviate neuroinflammatory responses in models of focal cerebral ischemia, even at doses insufficient to mobilize stem cells . This suggests that CXCR4 blockade may contribute to cardioprotection through multiple mechanisms.

For optimal experimental design in cardiac regeneration studies, timing of CXCR4 antagonist administration relative to injury is critical, as is the integration of functional cardiac assessments (echocardiography, hemodynamics) with cellular and molecular analyses.

What methodological considerations are important when studying CXCR4-mediated stem cell homing in porcine disease models?

Studying CXCR4-mediated stem cell homing in porcine disease models requires careful attention to several methodological aspects:

Quantification of SDF-1 gradients: Effective stem cell homing depends on SDF-1 gradients between circulation and target tissues. Researchers should quantify SDF-1 expression in target tissues (e.g., infarcted myocardium) at multiple timepoints using techniques such as:

  • ELISA for protein quantification

  • RT-qPCR for mRNA expression

  • Immunohistochemistry for spatial distribution

Research has demonstrated that myocardial SDF-1 expression is upregulated rapidly after MI and maintained for approximately one week, establishing a critical window for homing .

Stem cell tracking methodologies: To assess homing efficiency, mobilized or transplanted stem cells must be tracked within the porcine model:

  • Direct labeling approaches: Fluorescent dyes (DiI, CFSE), radioisotopes, or paramagnetic particles

  • Genetic labeling: Introduction of reporter genes (GFP, luciferase) into mobilized cells

  • Sex-mismatched transplantation: Y-chromosome detection when male cells are transplanted into female recipients

Each approach has specific advantages and limitations regarding sensitivity, duration of detection, and potential effects on cell function.

Functional assessment of homed cells: Beyond localization, determining the functional integration and contribution of homed cells is essential:

  • Differentiation status assessment using lineage-specific markers

  • Paracrine factor secretion profiles

  • Electrical coupling with host tissue (for cardiac applications)

  • Vascular integration (for angiogenic responses)

Experimental timing considerations: The timing of interventions relative to disease progression significantly impacts homing efficiency. Research shows different stem cell populations exhibit distinct mobilization and homing kinetics, with CD34+ cells returning to baseline faster (2 hours) than CD133+ cells (24 hours) . Experimental designs should incorporate these temporal dynamics.

For comprehensive assessment, multi-modality approaches combining molecular, cellular, and functional readouts provide the most informative results when studying CXCR4-mediated stem cell homing in porcine models.

How can the immunomodulatory effects of CXCR4-expressing cells be evaluated in porcine models?

Evaluating the immunomodulatory effects of CXCR4-expressing cells in porcine models requires multifaceted approaches that assess both cellular and molecular aspects of immune regulation:

Mixed lymphocyte reaction (MLR) assays: CXCR4+ stem cells mobilized by antagonists have demonstrated immunomodulatory properties. Research has shown that CXCR4 antagonist-mobilized autologous hematopoietic stem cells can suppress allogeneic MLR and prolong islet allograft survival . For porcine models, MLR assays should be optimized to:

  • Compare the suppressive capacity of different CXCR4+ cellular subsets

  • Evaluate dose-dependent effects

  • Determine the durability of suppression

  • Identify the mechanism of suppression (contact-dependent vs. soluble factors)

Cytokine profile analysis: Comprehensive assessment of pro- and anti-inflammatory cytokine production provides insight into immunomodulatory mechanisms. Techniques including:

  • Multiplex cytokine assays from plasma samples

  • Intracellular cytokine staining and flow cytometry

  • Cytokine mRNA expression analysis from sorted cell populations

  • In situ hybridization in tissue sections

These approaches can reveal the complex interplay between CXCR4+ cells and immune effector cells.

T-cell functional assays: Since CXCR4 blockade can interrupt the costimulation effects of SDF-1 on CD4+ T-cells , analyzing T-cell functional parameters is critical:

  • Proliferation assays using CFSE dilution

  • Activation marker expression (CD25, CD69)

  • Regulatory T-cell induction and function

  • Effector T-cell differentiation patterns

In vivo models of inflammation and tissue injury: The ultimate test of immunomodulatory capacity is the ability to ameliorate inflammation in relevant disease models. Research has demonstrated that CXCR4+ MSCs, including porcine CD271-MSCs, possess immunomodulating and allosuppressive properties . Quantitative assessments should include:

  • Inflammatory cell infiltration in target tissues

  • Tissue damage markers

  • Functional recovery parameters

  • Long-term outcomes

When designing these studies, researchers should recognize that the beneficial effects of CXCR4 antagonists are likely multifaceted, involving both direct CXCR4 blockade and mobilized cell-mediated immunomodulation. Experimental designs that can distinguish between these mechanisms will provide the most valuable insights.

What are common pitfalls in CXCR4 detection assays and how can they be addressed?

CXCR4 detection assays present several technical challenges that researchers should anticipate and address:

Antibody specificity issues: Commercial antibodies against CXCR4 vary in specificity and sensitivity, particularly when used across species:

  • Problem: Some antibodies recognize conformation-dependent epitopes that may be altered during sample processing or in recombinant proteins.

  • Solution: Validate antibodies using positive and negative controls, including CXCR4-knockout cells or tissues and cells with confirmed high CXCR4 expression. For pig CXCR4, test multiple antibody clones and consider using antibodies specifically validated for porcine samples .

Receptor internalization affecting detection: CXCR4 undergoes rapid internalization upon ligand binding:

  • Problem: Processing delays or inadvertent activation can reduce surface detection.

  • Solution: Process samples rapidly at 4°C, consider using internalization inhibitors during processing, and standardize handling protocols. For flow cytometry, compare surface staining with permeabilized samples to assess internalized receptors.

ELISA interference factors: When using sandwich ELISA for CXCR4 detection:

  • Problem: Heterophilic antibodies and soluble CXCR4 fragments can interfere with accurate quantification.

  • Solution: Include heterophilic blocking reagents in sample diluents, run serial dilutions to confirm linearity, and consider alternative detection methods for validation. Commercial pig CXCR4 ELISA kits have specific sensitivity parameters (0.059 ng/mL) and detection ranges (0.16-10 ng/mL) that should be considered during experimental design .

Tissue-specific expression variations: CXCR4 expression varies substantially between tissue types and can be regulated by microenvironmental factors:

  • Problem: Expression levels in one tissue may not reflect systemic expression.

  • Solution: Sample multiple tissues when possible, consider the microenvironmental context, and use appropriate tissue-specific normalizing genes for transcript analysis.

For accurate CXCR4 quantification, researchers should employ multiple detection methods when possible (combining protein and mRNA detection) and carefully optimize protocols for the specific tissue and sample type being analyzed.

How can researchers troubleshoot problems in stem cell mobilization experiments with CXCR4 antagonists?

When troubleshooting stem cell mobilization experiments using CXCR4 antagonists in porcine models, researchers should systematically address potential issues:

Inadequate mobilization response:

  • Problem: Limited increase in circulating stem cells despite antagonist administration.

  • Diagnostic approach: Verify antagonist activity through in vitro functional assays (calcium flux inhibition) prior to in vivo use. Confirm proper dosing based on body weight and administration route. Research shows that different stem cell populations respond differently to mobilization, with CD34+ cells peaking at 0.5-1 hour while CD133+ and CD271+ cells have different kinetics .

  • Solution: Optimize dose and timing of blood collection based on cell type of interest. Consider sequential dosing strategies as studies have shown enhanced mobilization after second doses of antagonists like TG-0054 .

Variability in mobilization between animals:

  • Problem: High inter-individual variability in stem cell mobilization response.

  • Diagnostic approach: Assess baseline stem cell counts prior to antagonist administration. Check for concurrent health issues, medications, or stress factors that might affect mobilization.

  • Solution: Increase sample size to account for variability. Consider stratifying animals based on baseline stem cell counts. Standardize housing, handling, and experimental conditions.

Challenges in identifying rare mobilized cell populations:

  • Problem: Difficulty in detecting low-frequency stem cell populations in peripheral blood.

  • Diagnostic approach: Verify antibody specificity using appropriate controls. Assess whether enrichment steps may be causing cell loss.

  • Solution: Implement pre-enrichment protocols (density gradient separation, magnetic sorting) before flow cytometry. Increase blood volume collected. Use multi-parameter flow cytometry with lineage depletion strategies to enhance detection of rare populations.

Functional impairment of mobilized stem cells:

  • Problem: Mobilized cells show reduced functionality in colony-forming assays or therapeutic applications.

  • Diagnostic approach: Compare colony-forming efficiency (CFE) of mobilized cells with bone marrow-derived counterparts. Assess expression of key functional markers.

  • Solution: Optimize collection and processing protocols to minimize stress to cells. Consider adjusting antagonist dosing, as excessive exposure may affect functionality. Research has shown that mobilized porcine MSCs maintain their differentiation potential and express markers similar to bone marrow-derived MSCs .

By systematically addressing these common challenges, researchers can optimize stem cell mobilization protocols in porcine models for various research and therapeutic applications.

What are the critical quality control parameters for recombinant pig CXCR4 production?

Ensuring high-quality recombinant pig CXCR4 production requires rigorous quality control at multiple steps:

Protein purity and homogeneity assessment:

  • SDS-PAGE analysis: Purified recombinant pig CXCR4 should show a predominant band at the expected molecular weight (approximately 39-40 kDa for the unmodified receptor). Multiple bands or smearing may indicate degradation or heterogeneous glycosylation.

  • Size exclusion chromatography: Assesses protein aggregation state and homogeneity, critical for functional studies.

  • Mass spectrometry: Confirms protein identity and can detect post-translational modifications or truncations.

Functional validation:

  • Ligand binding assays: Direct binding assays with labeled SDF-1α or competitive binding assays with known antagonists like AMD3100 should demonstrate specific, saturable binding with expected affinity parameters.

  • Signaling assays: Calcium mobilization assays using calcium-sensing dyes like Indo-1 should show concentration-dependent responses to SDF-1α that can be inhibited by antagonists. Studies have demonstrated that CXCR4 activation produces calcium flux that can be blocked by receptor desensitization or antagonist pretreatment .

  • Chemotaxis assays: Cells expressing the recombinant receptor should migrate in response to SDF-1α gradients (typically 100 ng/ml) in transwell migration chambers .

Structural integrity:

  • Circular dichroism spectroscopy: Confirms secondary structure content expected for a seven-transmembrane protein.

  • Thermal stability assays: Monitors protein unfolding to assess stability, with and without ligands or antagonists.

  • Conformational antibody binding: Antibodies recognizing conformation-dependent epitopes should bind properly folded receptor.

Batch consistency parameters:

  • Lot-to-lot reproducibility in functional assays

  • Consistent glycosylation profile (if expressed in mammalian or insect systems)

  • Stability during storage (freeze-thaw cycles, long-term storage conditions)

  • Endotoxin levels below acceptable thresholds for intended applications

For CXCR4-expressing stable cell lines, additional parameters include consistent receptor expression levels over passage number, absence of mycoplasma contamination, and reproducible responses to standard agonists and antagonists across multiple passages.

Implementing these quality control measures ensures that experimental outcomes using recombinant pig CXCR4 are reliable and reproducible across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.