Recombinant Pig Calcitonin gene-related peptide type 1 receptor (CALCRL)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Commercial recombinant pig CALCRL is produced using multiple expression systems:

Product CodeExpression SystemPurityApplication
CSB-CF848799PIE. coli>90%Ligand binding assays
CSB-EP848799PI1E. coli (partial)>85%Antibody production
CSB-YP803048PI (RAMP1)Yeast>80%Receptor complex studies

Key challenges in production include maintaining solubility and ensuring proper glycosylation, which requires co-expression with RAMP1 for endoplasmic reticulum export .

Signaling Mechanism

The receptor operates via cAMP-dependent pathways:

  1. CGRP Binding: Induces conformational changes in CLR-RAMP1 complex

  2. G-protein Activation: Couples with Gαs subunit, elevating intracellular cAMP (>10>10-fold increase in HEK293 cells)

  3. RCP Interaction: Direct binding to CLR's intracellular domain (residues 387–461) facilitates signal transduction

Notably, Trp84 in RAMP1 stabilizes CLR-RAMP1 interaction and enhances membrane localization . Antagonists like BIBN4096BS exhibit species-specific efficacy due to RAMP1 polymorphisms .

Reproductive Physiology

  • Oviduct Function: CALCRL mediates adrenomedullin-induced chloride secretion (IscI_{sc} increase: 108.6 ± 14.2 μA/cm²) via cAMP/Ca²⁺ pathways in pig oviduct epithelial cells .

Inflammation Modulation

  • Nucleus Accumbens: CALCRL and RAMP1 expression increases 2.3-fold during inflammation, correlating with pain sensitization .

Lymphatic Regulation

  • Genetic Knockout: Lymphatic-specific Calcrl deletion in mice causes intestinal lymphangiectasia and impaired mucosal repair (villus apoptosis ↑47%) . While not directly tested in pigs, this suggests evolutionary conserved roles in lymphatic biology.

Detection and Quantification

The Abbexa Pig CALCRL ELISA Kit (Detection range: 0.156–10 ng/ml) uses a sandwich assay with:

  • Sensitivity: 0.078 ng/ml

  • Inter-assay CV: <12%

  • Sample Types: Tissue homogenates, cell lysates

Therapeutic Applications

AreaPotential UseCurrent Status
Migraine TherapyCGRP receptor antagonists (e.g., telcagepant)Phase III trials
Pulmonary HypertensionAdrenomedullin receptor agonismPreclinical studies
Inflammatory PainRAMP1-specific inhibitorsIn vitro validation

Challenges and Limitations

  1. Structural Instability: Requires lipid bilayers for crystallization

  2. Species Specificity: Human CALCRL-RAMP1 shows 60% lower antagonist affinity vs rodent isoforms

  3. Co-expression Dependency: Functional assays mandate simultaneous RAMP1/RCP expression

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your requests to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize development with that tag.
Synonyms
CALCRL; CGRPR; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-462
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
ETEEENPDDLIQLTVTRNKIMTAQYECYQKIMQDPIQQTEGIYCNRTWDGWLCWNDVAAG TESMQHCPDYFQDFDPSEKVTKICDQDGNWFRHPESNRTWTNYTQCNINTHEKVQTALNL FYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSIVTIIHLTAVANN QALVATNPVSCKVFQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWG FPLIPACIHAVARRLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLK VTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILVHYQGLLVS TIYCFFNGEVQAILRRNWNQYKIQFGNSFSHSDALRSASYTVSTISDGAGYSHDYPSEHL NGKSIHDMENIVIKPEKLYD
Uniprot No.

Target Background

Function
This receptor acts as a receptor for calcitonin-gene-related peptide (CGRP) in conjunction with RAMP1, and for adrenomedullin alongside RAMP2 or RAMP3. The receptor's activity is mediated by G proteins that stimulate adenylyl cyclase.
Gene References Into Functions
  1. Data suggests that adrenomedullin (ADM) enhances oviductal fluid secretion through chloride secretion mediated by calcium and cAMP signaling pathways (not nitric oxide signaling pathway), via the calcitonin gene-related peptide receptor (CGRPR; not adrenomedullin receptor). PMID: 23966326
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in lung and coronary artery.

Q&A

What is the molecular structure of porcine CALCRL?

Porcine CALCRL is a G protein-coupled receptor consisting of 462 amino acids, sharing approximately 93% sequence identity with human CALCRL. Northern blot analysis has identified a messenger RNA species of 5.4 kilobases, which is abundantly expressed in pig lung tissue. The receptor's functional properties are determined by its association with receptor-activity-modifying proteins (RAMPs), which alter ligand specificity .

Methodologically, sequence analysis of porcine CALCRL can be performed using cDNA libraries (as demonstrated with the porcine lung complementary DNA library) and standard molecular cloning techniques. For protein structure analysis, researchers typically employ predictive modeling based on sequence homology with known GPCR structures .

How is CALCRL expression distributed across porcine tissues?

CALCRL shows variable expression across porcine tissues, with particularly high abundance in the lung. CGRP-positive nerve fibers containing CALCRL have been identified in the trabecula and parenchymal areas of pig spleen. Receptor studies have demonstrated that the CGRP binding site in pig spleen membranes has an average Kd of 2.24 ± 0.48 nM and Bmax of 78 ± 4.09 fmol/mg of protein .

Methodologically, researchers can detect tissue-specific expression using:

  • Northern blot analysis for mRNA detection

  • Immunohistochemistry for protein localization

  • Receptor binding assays with radiolabeled ligands such as [125I]CGRP

  • Quantitative RT-PCR using primers such as CALCRL-F (5'-GCAGCAGCTACCTAGCTTGAA-3') and CALCRL-R (5'-TTCACGCCTTCTTCCGACTC-3')

What are the pharmacological characteristics of porcine CALCRL receptor complexes?

The pharmacological profile of porcine CALCRL varies significantly depending on which RAMP it associates with:

  • CALCRL+RAMP1: Functions primarily as a CGRP receptor with high affinity (ED50 ~10^-10 mol/L for CGRP). AM also activates this receptor complex but with approximately 100-fold lower potency .

  • CALCRL+RAMP2 or CALCRL+RAMP3: Functions primarily as an adrenomedullin (AM) receptor with high affinity (activation from 10^-10 mol/L). CGRP can also activate these complexes but with 100-500 fold lower potency .

Methodologically, these profiles can be determined through cAMP production assays in transfected cell lines. For example, COS-7 cells transfected with porcine CALCRL and different RAMPs show distinct adenylyl cyclase activation patterns when stimulated with various concentrations of CGRP, AM, CT (calcitonin), or AMY (amylin) .

What are the preferred expression systems for recombinant porcine CALCRL production?

Several expression systems have proven effective for recombinant porcine CALCRL production:

  • Human Embryonic Kidney (HEK-293) cells: Demonstrated successful expression of functional CALCRL with appropriate pharmacological profiles. Ligand binding studies showed high-affinity receptor for CGRP with a Kd of 38.5 pM .

  • COS-7 cells: Commonly used for co-expression studies with RAMPs to analyze receptor complex functionality through cAMP production assays .

  • Porcine Aortic Smooth Muscle Cells (PASMC): Used for species-specific cellular background studies of CALCRL and RAMP interactions .

Methodologically, researchers should consider:

  • Optimizing transfection conditions specific to cell type

  • Including appropriate controls for endogenous RAMP expression

  • Verifying receptor expression through immunoblotting or fluorescent tagging

  • Confirming functionality through ligand binding and signaling assays

How can binding affinity of ligands to porcine CALCRL be accurately measured?

Accurate measurement of ligand binding to porcine CALCRL requires several methodological considerations:

  • Competitive binding assays: Using [125I]CGRP as the radiolabeled ligand, researchers can determine the pharmacological profiles of various competing ligands. Studies have shown that binding of [125I]CGRP to expressed porcine CALCRL is decreased in the presence of nonhydrolyzable GTP analogs such as guanosine 5'-(gamma-thio)-triphosphate, confirming G-protein coupling .

  • Functional assays: Adenylyl cyclase activation can be measured to determine EC50 values. For porcine CALCRL expressed in HEK-293 cells, CGRP stimulates adenylyl cyclase with an EC50 of 2.5 nM. Specific antagonists like CGRP-(8-37)α can inhibit CGRP-mediated responses in a competitive manner, confirming receptor specificity .

  • Membrane preparation: For spleen tissue, membrane preparations showing a Kd of 2.24 ± 0.48 nM for CGRP binding sites have been established, allowing for tissue-specific analysis of receptor characteristics .

How does CALCRL signaling affect lymphocyte function in porcine models?

CALCRL signaling demonstrates complex, concentration-dependent effects on porcine lymphocyte function:

  • T-lymphocyte proliferation: CGRP exerts a dose-dependent suppressive effect on spleen T lymphocyte proliferation, with maximal effect at 10^-9 M concentration. For peripheral blood T lymphocytes, the same suppressive effect occurs but at a higher concentration of 10^-6 M .

  • Temporal effects: Preincubation with CGRP leads to a stimulation of peripheral blood lymphocytes in response to Concanavalin A (ConA), contrasting with the suppressive effect seen when CGRP and mitogen are present simultaneously. Interestingly, this preincubation effect is not observed in spleen T lymphocytes .

Methodologically, researchers investigating these effects should:

  • Control for the timing of CGRP exposure relative to mitogenic stimulation

  • Account for concentration-dependent effects that may vary between tissue sources

  • Include appropriate proliferation assays (e.g., [3H]thymidine incorporation)

  • Consider the influence of different mitogenic stimuli (e.g., ConA vs. other T cell activators)

What is the relationship between CALCRL expression and lymphatic system function?

Studies using temporal deletion of CALCRL in mouse models have revealed critical roles in lymphatic system maintenance:

  • Lymphangiectasia development: Loss of CALCRL leads to multi-organ lymphangiectasia (pathological dilation of lymphatic vessels), particularly evident in intestinal lacteals and submucosal lymphatic vessels .

  • Lymphatic permeability: CALCRL signaling appears crucial for regulating lymphatic vessel permeability, potentially through reorganization of junctional proteins like VE-cadherin and ZO-1. Loss of CALCRL leads to increased permeability and lymphatic insufficiency .

While these findings are from mouse models, they suggest important conservation of CALCRL function in the lymphatic system across mammalian species, which may be relevant to porcine research.

Methodologically, researchers investigating CALCRL in lymphatic function can employ:

  • Conditional knockout models using Cre-loxP systems

  • Fluorescent lymphangiography to assess vessel integrity and function

  • Immunostaining for lymphatic markers like Lyve-1 and podoplanin

  • Permeability assays to quantify vessel barrier function

What is the potential role of CALCRL in cancer research using porcine models?

CALCRL has emerged as a significant factor in cancer research, with potential relevance to porcine models:

Methodologically, researchers investigating CALCRL in cancer contexts should consider:

  • Quantifying expression levels using qRT-PCR with primers specific to porcine CALCRL

  • Knockdown studies using shRNA approaches as demonstrated in glioma cell lines

  • Cell proliferation assays (e.g., Celigo assay, MTT assay)

  • Clone formation assays to assess tumorigenic potential

  • Flow cytometry for apoptosis measurement

How can recombinant porcine CALCRL be used in drug discovery for migraine treatments?

CGRP receptor antagonists represent a significant therapeutic class for migraine treatment, with porcine CALCRL offering valuable research applications:

  • Pharmacological screening: Recombinant porcine CALCRL can be used to test novel CGRP receptor antagonists. The receptor antagonist CGRP-(8-37)α inhibits CGRP-mediated responses in a competitive manner in porcine systems .

  • Species-specific efficacy: Given that porcine CALCRL shares 93% sequence identity with human CALCRL, it provides a valuable model for predicting human responses while allowing for analysis of species-specific differences .

  • Functional assays: CGRP stimulates adenylyl cyclase through CALCRL with an EC50 of 2.5 nM in porcine receptor systems, providing a quantifiable readout for antagonist screening .

Methodologically, researchers should:

  • Establish stable cell lines expressing porcine CALCRL with RAMP1

  • Develop high-throughput cAMP assays for antagonist screening

  • Compare potency between porcine and human receptor systems

  • Assess structure-activity relationships of compounds

  • Consider downstream signaling pathways beyond cAMP that might be relevant to migraine pathophysiology

How do RAMPs molecularly interact with porcine CALCRL to alter ligand specificity?

The molecular basis for RAMP-mediated alteration of CALCRL ligand specificity involves complex protein-protein interactions:

  • Ligand specificity determination: In porcine systems, RAMP1 converts CALCRL to a CGRP-preferring receptor, while RAMP2 and RAMP3 convert it to an adrenomedullin (AM)-preferring receptor. These specificities are clearly defined, with 100-fold differences in potency for preferred versus non-preferred ligands .

  • Structural differences: The amino acid sequences of porcine RAMPs show 65.9-77.1% conservation compared to human and rat counterparts, with higher conservation in the C-terminal half including the transmembrane domain. These sequence variations likely contribute to subtle species-specific differences in CALCRL-RAMP interactions .

  • Critical domains: The transmembrane regions of both CALCRL and RAMPs are highly conserved across species, suggesting their crucial role in maintaining functional interactions .

Methodologically, researchers investigating these interactions should consider:

  • Mutagenesis studies targeting interaction domains

  • Co-immunoprecipitation experiments to confirm physical association

  • FRET or BRET approaches to study dynamic interactions

  • Computational modeling based on known GPCR-accessory protein complexes

  • Comparative analysis across species to identify critical conserved residues

What are the methodological challenges in distinguishing CGRP versus adrenomedullin effects in porcine CALCRL systems?

Distinguishing between CGRP and adrenomedullin effects in porcine systems presents several methodological challenges:

  • Receptor complex heterogeneity: Cells may express multiple RAMP subtypes, creating mixed populations of CALCRL receptor complexes with differing ligand preferences. This heterogeneity can obscure the source of observed signaling effects .

  • Overlapping potencies: While CGRP is 100-fold more potent at CALCRL-RAMP1 than adrenomedullin, and adrenomedullin is 100-500 fold more potent at CALCRL-RAMP2/3 than CGRP, both ligands can activate all receptor complexes at higher concentrations .

  • Endogenous expression: Many cell types express endogenous levels of both CALCRL and RAMPs, complicating interpretation of recombinant studies .

Methodologically, researchers can address these challenges by:

  • Using specific antagonists like CGRP-(8-37)α to block CGRP-specific effects

  • Conducting experiments in cell lines with minimal endogenous expression of RAMPs (e.g., COS-7 cells show low baseline RAMP expression)

  • Employing RNA interference to selectively knockdown specific RAMPs

  • Using concentration-response curves to identify the likely receptor complex mediating an effect

  • Comparing effects in cells transfected with defined CALCRL-RAMP combinations

How can single-cell analysis techniques be applied to study CALCRL signaling in heterogeneous porcine tissues?

Single-cell analysis offers powerful approaches to dissect CALCRL signaling in complex tissues:

  • Cell-specific expression patterns: CALCRL shows tissue-specific expression, with particularly high levels in lung and differential expression in immune cell subsets like T lymphocytes from spleen versus peripheral blood .

  • Dynamic signaling responses: CALCRL signaling induces concentration-dependent effects that vary by cell type and physiological context, such as the differential effects of CGRP on spleen versus peripheral blood T lymphocytes .

Methodologically, researchers could apply:

  • Single-cell RNA sequencing to identify cell populations expressing CALCRL and specific RAMPs within heterogeneous tissues

  • Mass cytometry (CyTOF) with phospho-specific antibodies to track CALCRL-induced signaling events at single-cell resolution

  • Live-cell imaging with FRET-based cAMP sensors to monitor real-time signaling dynamics

  • Spatial transcriptomics to map CALCRL and RAMP expression patterns within tissue architecture

  • Patch-clamp electrophysiology for single-cell functional responses in neurons or other excitable cells expressing CALCRL

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.