Recombinant Pig CD9 antigen (CD9)

Shipped with Ice Packs
In Stock

Description

Biological Functions in Swine

CD9 is ubiquitously expressed in porcine tissues and immune cells, with roles in:

  • Immune Regulation: Present on monocytes, B cells, and subsets of T cells, where it correlates with central memory CD4+ T cell frequency .

  • Reproductive Biology: Critical for sperm-egg fusion during fertilization . Blocking CD9 with antibodies reduces sperm binding (1.2 ± 0.2 vs. 2.5 ± 0.4 sperm/oocyte) and penetration rates (16.6% vs. 70.3%) .

  • Membrane Remodeling: Facilitates extracellular vesicle (EV) biogenesis and exosome release, enhancing intercellular communication .

Role in Sperm-Egg Interaction

CD9 localizes on the plasma membrane of porcine oocytes, with expression peaking during meiotic maturation . Functional studies demonstrate:

ParameterAnti-CD9 Antibody-Treated OocytesControl Oocytes
Sperm Binding/Oocyte1.2 ± 0.22.5 ± 0.4
Sperm Penetration Rate16.6%70.3%

Data derived from in vitro fertilization assays .

CD9 deficiency disrupts membrane organization, impairing fusion events essential for fertilization .

Immunological Relevance in Porcine Models

  • T Cell Function: CD9+ CD4+ T cells exhibit enhanced cytokine production and longevity during influenza A virus-specific responses .

  • Biomedical Applications: Novel monoclonal antibodies against porcine CD9 enable tracking of immune cell dynamics and membrane remodeling in disease models .

Applications in Biomedical Research

  • Exosome Research: CD9 is a marker for exosomes, aiding in drug delivery and cancer diagnostics .

  • Viral Studies: Facilitates viral entry (e.g., MERS-CoV) by interacting with host receptors like DPP4 .

  • Cancer Research: Acts as a metastasis suppressor in solid tumors by inhibiting cell motility .

Research Findings and Case Studies

  • Case Study 1: Overexpression of CD9 in human cell lines increased exosome-like EV secretion and improved lentiviral transduction efficiency by 2–3 fold .

  • Case Study 2: CD9-deficient mice showed delayed endometrial re-epithelialization post-pregnancy, linked to reduced VEGF levels in uterine secretions .

Challenges and Future Directions

  • Antibody Specificity: Cross-reactivity with human or other species’ CD9 requires validation .

  • Therapeutic Potential: Targeting CD9 in cancer or fertility treatments risks off-target effects (e.g., platelet aggregation) .

  • Future Goals: Develop CD9-modulated exosomes for targeted therapies and refine recombinant production for clinical use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
CD9; CD9 antigen; CD antigen CD9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
CD9
Target Protein Sequence
PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNNSSFYTGVYIL IGAGALMMVVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDQVIKEVQD FYRDTYNKLKGKDDPQRETLKAIHYALDCCGLMGEVEQLLADICPQRDVLSSLPMKPCPE AIKEVFQNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Uniprot No.

Target Background

Function

CD9 is an integral membrane protein associated with integrins, regulating processes such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Expressed on the oocyte surface, it plays a crucial role in sperm-egg fusion, potentially by organizing membrane-associated multiprotein complexes and modulating membrane morphology. In myoblasts, CD9 interacts with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. In macrophages, its interaction with CD81 and β1/β2 integrins prevents the formation of multinucleated giant cells involved in phagocytosis of complement-opsonized particles. Furthermore, CD9 inhibits fusion of mononuclear cell progenitors into osteoclasts, essential for bone resorption. It functions as a receptor for PSG17 and is involved in platelet activation, aggregation, paranodal junction formation, cell adhesion, motility, and tumor metastasis.

Gene References Into Functions
  1. Analysis of tetraspanin CD9 distribution in normal porcine tissues. PMID: 20585885
Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.
Tissue Specificity
Ubiquitous.

Q&A

What is CD9 and how is it characterized in porcine tissues?

CD9 is a cell surface glycoprotein belonging to the tetraspanin (TM4SF) family. In pigs, CD9 is primarily characterized as a 24 kDa membrane protein expressed on various cell types including oocytes, monocytes, granulocytes, and a fraction of lymphocytes. The protein is localized on the plasma membrane of oocytes at different developmental stages and participates in cellular adhesion processes. Immunohistochemistry, immunofluorescence, and immunoblotting are commonly used techniques to detect CD9 expression in porcine tissues . Research indicates that CD9 quantity significantly increases as porcine oocytes undergo maturation, reaching peak levels after 44 hours of in vitro culture .

What are the primary functional roles of CD9 in porcine reproductive biology?

CD9 plays essential roles in porcine fertilization, particularly in sperm-oocyte interactions. Research demonstrates that CD9 is expressed during early oocyte growth and meiotic maturation in pigs. It directly participates in sperm binding to ooplasma and sperm penetration into oocytes . When porcine oocytes are treated with anti-CD9 antibodies, both sperm binding (reduced from 2.5 ± 0.4 to 1.2 ± 0.2 per oocyte) and sperm penetration rates (reduced from 70.3% to 16.6%) are significantly diminished . These findings parallel observations in other mammalian models where CD9 knockout results in fertility impairment despite normal ovulation and maturation.

How does CD9 expression vary across different porcine immune cell populations?

CD9 shows distinctive expression patterns across porcine immune cell populations. It is highly expressed on monocytes (CD172a^hi and CD16^hi cells) and is present on a subpopulation of B cells (identified as sIgM+, CD21+, or Siglec-10+ cells). Among T cells, CD9 is expressed on fractions of CD4+ and CD8α+ cells but is mostly absent on NK cells (CD16^lo), CD8β+ T cells, and γδ T cells . Age-related differences exist in CD9 expression, with significantly higher expression observed in older animals (>2 years) compared to younger pigs (8-12 months) . This varied expression suggests CD9 may serve as a useful marker for distinguishing functional subsets of immune cells.

What are the optimal methods for detecting CD9 in porcine tissues and cells?

For comprehensive CD9 detection in porcine tissues, a multi-technique approach is recommended:

  • Immunohistochemistry: Effective for tissue localization studies, utilizing paraformaldehyde fixation (4%) followed by specific anti-CD9 monoclonal antibody incubation.

  • Immunofluorescence: For cellular localization, specimens should be fixed, permeabilized with 0.5% Triton X-100, and incubated with primary anti-CD9 antibodies followed by fluorophore-conjugated secondary antibodies .

  • Immunoblotting: For protein quantification, cell lysates are analyzed under reducing conditions, with CD9 typically appearing as a 22-24 kDa band in porcine samples .

  • Flow cytometry: For immune cell populations, two-color staining protocols are recommended, using biotin-labeled CD9 antibodies in conjunction with lineage-specific markers .

The selection of detection method should align with experimental objectives, with flow cytometry being particularly valuable for phenotyping heterogeneous cell populations.

How can researchers effectively produce and validate recombinant pig CD9 antigen?

Based on established protocols for recombinant tetraspanin production, the following methodological approach is recommended:

  • Expression system selection: Mammalian expression systems (such as HEK293 cells) are preferable for proper folding and post-translational modifications of transmembrane proteins like CD9 .

  • Construct design: The coding sequence should include a signal peptide and a C-terminal purification tag (His-tag) for detection and purification, similar to human CD9 production methodologies .

  • Purification strategy:

    • Lyophilize from filtered solution (0.22 μm) in PBS, pH 7.4, with 10% trehalose as stabilizer

    • Purify to >95% as determined by SDS-PAGE

    • Quality control should include endotoxin testing (<1.0 EU per μg by LAL method)

  • Validation assessments:

    • Structural integrity: SDS-PAGE analysis under reducing conditions

    • Functional validation: Binding assays with known CD9 interaction partners

    • Antibody recognition: Western blot using validated anti-CD9 antibodies

    • Biological activity: Sperm-oocyte binding inhibition assays

What are effective approaches for studying CD9 function in porcine fertilization?

To investigate CD9's role in porcine fertilization, several experimental approaches have proven effective:

  • In vitro fertilization with antibody blocking: Treat mature oocytes with anti-CD9 antibodies before sperm co-incubation to assess the impact on fertilization rates. This approach has demonstrated significant reductions in both sperm binding (48% decrease) and penetration rates (53.7% decrease) .

  • CD9 expression temporal analysis: Monitor CD9 expression during oocyte maturation using immunoblotting techniques to correlate protein levels with developmental competence .

  • Localization studies: Combine zona pellucida removal techniques with immunofluorescence to precisely map CD9 distribution on the oocyte plasma membrane during different maturation stages .

  • Competitive inhibition experiments: Use recombinant CD9 protein fragments to competitively inhibit native CD9 function during fertilization, providing insights into functional domains.

  • Quantitative assessment parameters:

    ParameterControlAnti-CD9 TreatedReduction (%)
    Sperm binding (per oocyte)2.5 ± 0.41.2 ± 0.252%
    Sperm penetration rate70.3%16.6%76.4%

How can CD9 be utilized as a marker for porcine memory T cell research?

CD9 has emerged as a valuable marker for differentiating memory T cell subsets in porcine immunology. Research indicates that CD9 is more frequently expressed on central memory T cells and can effectively discriminate between different CD4+ T cell memory populations . For researchers investigating porcine T cell memory:

  • Multiparameter flow cytometry: Implement CD4/CD8α/CD9 staining panels to identify specific memory subsets. This approach revealed that virus-specific IFN-γ production after pseudorabies virus vaccination was dominated by cells with a CD9+ phenotype .

  • Functional correlation studies: CD9+ T cells demonstrate different cytokine production capacities compared to CD9- populations, particularly following viral challenge or vaccination. After pseudorabies virus vaccination, CD9+ subsets showed enhanced IFN-γ production when assessed 38-44 days post-immunization .

  • Age-dependent expression analysis: CD9 expression on porcine T cells increases with age, suggesting developmental regulation that should be accounted for in experimental design .

  • Antigen-specific response assessment: For vaccination studies, isolate CD9+ and CD9- T cell populations to independently assess their antigen-specific responses, using ELISPOT or intracellular cytokine staining protocols.

What are the challenges in comparing CD9 function across different mammalian species?

Cross-species functional analysis of CD9 presents several methodological challenges:

  • Structural variations: While CD9 demonstrates conserved functional domains across mammals, species-specific variations exist in glycosylation patterns and transmembrane organization. Human CD9 has a calculated molecular weight of 11.6 kDa (12 kDa observed in SDS-PAGE), while porcine CD9 appears as a 24 kDa protein .

  • Expression pattern differences: The cellular distribution of CD9 shows species-specific variations. In pigs, CD9 is absent on spermatozoa while present on oocytes , whereas distribution patterns differ in mice and humans.

  • Antibody cross-reactivity limitations: Many commercial antibodies developed against human CD9 show limited cross-reactivity with porcine CD9, necessitating species-specific reagents like the recently characterized 4H5CR4 monoclonal antibody .

  • Functional compensation mechanisms: Tetraspanin family proteins may demonstrate species-specific functional redundancy, complicating direct comparisons of knockout phenotypes across species.

  • Methodology standardization: To address these challenges, researchers should:

    • Validate antibody specificity using transfected cell lines expressing species-specific CD9

    • Perform parallel experimental protocols across species

    • Consider evolutionary conservation when designing recombinant constructs

    • Account for species-specific post-translational modifications

What techniques can differentiate native from recombinant CD9 in experimental systems?

To distinguish native porcine CD9 from recombinant versions in experimental systems, researchers can employ several advanced techniques:

  • Tag-specific detection: When using His-tagged recombinant CD9, employ anti-His antibodies in Western blot or immunoprecipitation experiments to specifically detect the recombinant protein .

  • Size-based differentiation: Recombinant CD9 fragments (such as Ser112-Ile195 constructs) will have distinct molecular weights compared to native full-length CD9, allowing differentiation via SDS-PAGE or size-exclusion chromatography .

  • Domain-specific antibodies: Develop antibodies targeting regions present in the native protein but absent in truncated recombinant versions, or vice versa.

  • Mass spectrometry analysis: Employ peptide mass fingerprinting to definitively identify and differentiate native from recombinant CD9 based on sequence variations and post-translational modifications.

  • Functional competition assays: Increasing concentrations of recombinant CD9 can be used to competitively inhibit native CD9 function in sperm-egg binding assays, with dose-response curves indicating biological activity.

How might CD9 function in porcine immune responses to viral pathogens?

Recent findings suggest CD9 may play significant roles in porcine antiviral immunity:

  • T cell subset functionality: CD9+ CD4+ T cells have demonstrated enhanced virus-specific IFN-γ production following pseudorabies virus vaccination , suggesting their importance in cellular immune responses to viral pathogens.

  • Memory response markers: CD9 expression appears to correlate with memory T cell phenotypes, potentially serving as a marker for monitoring vaccine-induced immunity in swine populations .

  • Future research strategies:

    • Investigate CD9's role in T cell responses to economically important porcine viruses (PRRSV, PCV2, ASF)

    • Examine correlation between CD9 expression and vaccine efficacy

    • Explore potential differences in viral receptor complex formation on CD9+ versus CD9- cells

    • Develop CD9-targeting strategies to enhance vaccine-induced memory responses

What are the technical considerations for optimizing recombinant pig CD9 stability and activity?

Based on established protocols for recombinant tetraspanin proteins, researchers should consider:

  • Storage optimization: Lyophilized recombinant CD9 should be stored at -20°C or lower, avoiding repeated freeze-thaw cycles. After reconstitution, storage at -70°C for up to 3 months under sterile conditions is recommended .

  • Reconstitution protocol: For optimal activity, reconstitute lyophilized protein with sterile water to a concentration of 0.2 µg/µl, centrifuging at 4°C before opening to recover all contents .

  • Detergent considerations: As a tetraspanin with multiple transmembrane domains, CD9 activity can be significantly affected by detergent selection. Mild non-ionic detergents like CHAPS or digitonin better preserve CD9 complexes compared to stronger detergents.

  • Stability enhancers: Consider addition of stabilizers like trehalose (10%) for long-term storage .

  • Functional assay development: Design application-specific tests to confirm biological activity after storage and reconstitution, such as binding inhibition assays for fertilization studies.

By implementing these specialized approaches, researchers can maintain optimal activity of recombinant pig CD9 preparations throughout experimental workflows.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.