Recombinant Pig Chloride intracellular channel protein 1 (CLIC1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Chloride Intracellular Channel Protein 1 (CLIC1)

Recombinant Pig CLIC1 is a bioengineered version of the native CLIC1 protein, optimized for research applications. CLIC1 belongs to the Chloride Intracellular Channel (CLIC) family, which regulates chloride ion transport across membranes. The recombinant pig variant is expressed in E. coli and includes an N-terminal His-tag for purification and detection. This protein is critical for studying chloride-dependent cellular processes, such as phagosome acidification, angiogenesis, and ion channel activity .

Functional Domains

  • GST C-terminal domain: Found in human CLIC1 homologs, though not explicitly confirmed in pig CLIC1 .

  • pH-dependent and redox-regulated membrane insertion: Likely retained due to conserved structural motifs .

Production and Purity

Recombinant Pig CLIC1 is produced via bacterial expression systems, with the His-tag enabling affinity chromatography purification. Key production parameters include:

ParameterDetail
Expression SystemE. coli with optimized growth conditions
PurificationNickel-affinity chromatography (His-tag)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with optional glycerol

Source: Creative Biomart .

Ion Channel Activity

CLIC1 forms voltage-dependent chloride channels in artificial bilayers, with conductances of ~161 pS (300 mM KCl) and ~68 pS (150 mM KCl) . In pig macrophages, it likely facilitates phagosomal acidification by enabling chloride influx, analogous to its role in murine macrophages .

pH and Redox Regulation

Applications in Research

ApplicationDescription
Chloride Transport StudiesInvestigate ion channel biophysics using planar bilayer assays .
Macrophage FunctionStudy phagosome maturation and immune response mechanisms .
AngiogenesisExamine CLIC1’s role in endothelial migration and network formation .
Viral ReplicationAssess CLIC1’s involvement in influenza A virus (IAV) replication .

Comparative Analysis with Human CLIC1

FeatureRecombinant Pig CLIC1Recombinant Human CLIC1
Expression HostE. coliE. coli
TagHis-tagHis-tag
Sequence Length2–110 aa1–241 aa (full-length)
Expression TissuesNot explicitly reportedHeart, placenta, liver, kidney, pancreas
FunctionChloride transport, phagosome acidificationAngiogenesis, cell cycle regulation

Sources: Creative Biomart , Assay Genie .

Key Research Findings

  1. Ion Channel Activity: CLIC1’s voltage-dependent conductance and anion selectivity (Cl⁻ > Br⁻ > I⁻) are critical for cellular signaling .

  2. Role in Angiogenesis: CLIC1 knockdown reduces endothelial migration and network formation by altering integrin expression (e.g., αVβ3, β1) .

  3. Macrophage Function: CLIC1 localizes to phagosomal membranes during zymosan phagocytosis, aiding acidification .

  4. Viral Replication: CLIC1 knockdown in A549 cells reduces influenza A virus progeny, suggesting a role in late-stage replication .

Limitations and Future Directions

  • Species-Specific Data: Most functional studies focus on human/murine CLIC1; pig-specific roles remain underexplored.

  • Structural Insights: High-resolution crystallography of pig CLIC1 could clarify its redox/pH-dependent conformational changes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CLIC1; Chloride intracellular channel protein 1; Nuclear chloride ion channel 27; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-110
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
CLIC1
Target Protein Sequence
AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPG GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDI
Uniprot No.

Target Background

Function
This protein inserts into membranes to form chloride ion channels. Channel activity is pH-dependent. Membrane insertion appears to be redox-regulated and may occur only under oxidizing conditions.
Protein Families
Chloride channel CLIC family
Subcellular Location
Nucleus. Nucleus membrane; Single-pass membrane protein. Cytoplasm. Cell membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of pig CLIC1 protein?

Pig CLIC1 belongs to the family of chloride intracellular channel proteins that can exist in both soluble and membrane-integrated forms. Like human CLIC1, it likely contains a putative transmembrane domain (PTM) essential for its proper membrane integration and channel characteristics . The protein can auto-insert into artificial bilayers and function as an ion channel, though with relatively poor selectivity based primarily on anion concentration . CLIC1 is approximately 31 kDa in size and functions in multiple cellular processes including angiogenesis, cell migration, and immune cell function .

How does recombinant pig CLIC1 compare structurally to human CLIC1?

While the search results don't specifically compare pig and human CLIC1, research on human CLIC1 indicates that the protein contains redox-sensitive regions and a putative transmembrane domain critical for its function . Researchers should expect conserved functional domains between species, particularly in the N-terminal region containing the transmembrane domain and in cysteine residues involved in redox regulation. Sequence alignment analysis between pig and human CLIC1 would be necessary to identify specific differences that might affect experimental design when working with the recombinant pig protein.

What expression systems are most effective for producing recombinant pig CLIC1?

Based on protocols used for human CLIC1, bacterial expression systems (particularly E. coli) are commonly employed for recombinant CLIC1 production. For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems such as HEK293 or CHO cells may be more appropriate. When expressing recombinant pig CLIC1, researchers should optimize codon usage for the expression system, consider adding purification tags (His-tag or GST-tag) that don't interfere with the protein's function, and carefully control induction conditions to maximize yield while maintaining proper folding .

What purification methods yield the highest purity of recombinant pig CLIC1?

For recombinant pig CLIC1 purification, a multi-step approach is recommended:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Intermediate purification using ion exchange chromatography

  • Polishing step using size exclusion chromatography to separate monomeric from oligomeric forms

This approach typically yields >95% pure protein suitable for structural and functional studies. Reducing agents should be included in buffers if the active monomeric form is desired, as CLIC1 can form dimers through disulfide bonds under oxidizing conditions .

How can one assess the membrane insertion capability of recombinant pig CLIC1 in experimental systems?

Membrane insertion of recombinant pig CLIC1 can be assessed using multiple complementary techniques:

  • Electrophysiological approaches: Patch-clamp techniques allow direct measurement of CLIC1 conductance in cellular or reconstituted membrane systems. Inside-out and outside-out configurations can determine the orientation of inserted protein, with the N-terminus typically projecting outside the cell and the C-terminus directed inward .

  • Biophysical methods: Techniques such as Tip-Dip electrophysiology can reveal the kinetics of insertion, where initial small conductance with slow kinetics is typically replaced by high conductance fast kinetics, representing the final stage of monomer insertion, aggregation, and cooperation .

  • Fluorescence approaches: Labeling recombinant CLIC1 with environment-sensitive fluorophores allows monitoring of conformational changes during membrane association and insertion.

To specifically study pH-dependent insertion, researchers should establish controlled pH gradients across the membrane and monitor conductance changes as pH shifts from neutral to acidic conditions .

What experimental approaches can distinguish between monomeric and oligomeric states of recombinant pig CLIC1?

Distinguishing between monomeric and oligomeric states of recombinant pig CLIC1 requires multiple analytical techniques:

  • Size exclusion chromatography (SEC): Can separate different oligomeric forms based on their hydrodynamic radius

  • Native PAGE: Preserves non-covalent interactions and separates proteins based on size and charge

  • Chemical crosslinking followed by SDS-PAGE: Captures transient interactions

  • Multi-angle light scattering (MALS): Provides absolute molecular weight information

  • Analytical ultracentrifugation: Offers high-resolution separation of different oligomeric states

Research indicates that CLIC1 exists primarily as monomers in solution but assembles into oligomeric structures upon membrane insertion . Warton et al. demonstrated that CLIC1 monomers insert individually into membranes and subsequently aggregate to form functional channels with approximately four times the conductance of initial insertions .

How does the redox state affect recombinant pig CLIC1 function and structure?

CLIC1 is a redox-regulated protein whose function is significantly influenced by the oxidation state of key cysteine residues. Experimental approaches to study this relationship include:

  • Site-directed mutagenesis: Replacing key cysteine residues to determine their role in redox sensitivity

  • Controlled oxidation/reduction experiments: Using defined concentrations of oxidizing/reducing agents to manipulate CLIC1 structure and function

  • Spectroscopic techniques: Monitoring structural changes in response to redox conditions

Research indicates that redox modifications affect CLIC1's membrane insertion capability and channel function . In cellular contexts, CLIC1 may participate in controlling redox environments, as suggested by studies showing CLIC1's influence on platelet P2Y12 receptor function, which requires free thiol groups (Cys17 and Cys270) for activity .

What is the role of pH in recombinant pig CLIC1 membrane insertion and ion channel function?

CLIC1 channel activity and membrane insertion are strongly pH-dependent processes:

  • pH-dependent insertion: CLIC1 assembly in lipid bilayers occurs via a pH-dependent two-state process. Experiments show that CLIC1 activity is lowest around neutral pH, with acidic conditions promoting insertion .

  • Structural basis: Low pH is believed to stimulate the putative transmembrane domain (PTM) for insertion into membranes. Structural experiments demonstrate conformational changes in CLIC1 under acidic conditions that expose hydrophobic regions necessary for membrane interaction .

  • Functional consequences: In macrophages, transient translocation of CLIC1 to the plasma membrane promotes phagosome acidification from pH 4.4 to 3.4, facilitating microbial killing and antigen processing .

When designing experiments to study pH-dependent aspects of pig CLIC1, researchers should include appropriate pH controls and consider the physiological relevance of the pH ranges tested.

What cellular assays are most informative for studying recombinant pig CLIC1 function?

Based on established research with human CLIC1, several cellular assays can be adapted for pig CLIC1 studies:

Assay TypeProtocol OverviewKey MeasurementsApplications
Migration AssayModified Boyden chamber with CLIC1 knockdown/overexpressionDistance migrated, number of migrating cellsAssess CLIC1's role in cell motility
Wound HealingCreate scratch in monolayer, monitor closure rateTime to wound closure, migration velocityEvaluate directed cell migration
Cell Growth AssayWST-8 colorimetric detection after growth periodAbsorbance correlating to cell numberDetermine CLIC1's effect on proliferation
Network FormationCulture cells between collagen layers, quantify networksSurface area coverage, branchpoint numberAssess angiogenic potential
Fibrin Bead AssayCells attached to dextran beads in fibrin matrixSprout number, branch number, lumen formationEvaluate sprouting and branching morphogenesis

For all assays, comparison between wild-type, CLIC1 knockdown, and CLIC1-overexpressing cells provides the most informative results. Tonini et al. demonstrated that patch-clamp techniques can measure CLIC1 conductance in both cellular and nuclear membranes, showing sensitivity and selectivity to chloride concentrations .

How can one effectively measure ion channel activity of recombinant pig CLIC1?

Multiple complementary approaches can be used to characterize the ion channel activity of recombinant pig CLIC1:

  • Planar lipid bilayer electrophysiology: Allows precise control of membrane composition and solution conditions on both sides of the membrane. This technique revealed that CLIC1 exhibits poor ion selectivity with conductance primarily based on anion concentration .

  • Patch-clamp technique: Can be applied to cells overexpressing CLIC1 or to artificial membrane systems. Inside-out and outside-out configurations help determine the orientation of the inserted protein, with findings suggesting the N-terminus projects outside the cell while the C-terminus faces inward .

  • Fluorescent ion indicators: Membrane-impermeant chloride-sensitive dyes can monitor chloride flux in vesicles containing reconstituted CLIC1.

  • Tip-Dip technique: Revealed that CLIC1 channel formation involves initial small conductance with slow kinetics followed by high conductance with fast kinetics, representing the final step of monomer insertion, aggregation, and cooperation .

What strategies can be employed for investigating CLIC1-protein interactions in research models?

To investigate CLIC1-protein interactions, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CLIC1 or its putative binding partners to pull down protein complexes

  • Proximity ligation assay (PLA): Detecting protein-protein interactions in situ with high sensitivity

  • Yeast two-hybrid screening: Identifying novel interaction partners

  • FRET/BRET assays: Measuring real-time interactions in living cells

  • Proteomic approaches: Mass spectrometry after crosslinking and pull-down

Research on human CLIC1 has identified interactions with several important proteins. In macrophages, CLIC1 colocalizes with the NADPH oxidase complex subunit Rac2 after stimulation with pro-inflammatory factors . Flow cytometry studies have shown that CLIC1 regulates the cell surface expression of various integrins involved in angiogenesis, including β1 and α3 subunits, as well as αVβ3 and αVβ5 .

What are common challenges in expressing soluble vs. membrane-integrated forms of recombinant pig CLIC1?

Researchers working with recombinant pig CLIC1 often encounter challenges balancing between the soluble and membrane-integrated forms:

  • Expression challenges:

    • Soluble form: Tends to aggregate at high concentrations

    • Membrane form: Often difficult to stabilize without appropriate lipid environment

  • Purification challenges:

    • Maintaining redox state during purification is critical for preserving native structure

    • Detergent selection affects stability and function of membrane-integrated form

  • Functional assessment:

    • Ensuring that purified protein retains ability to transition between forms

    • Verifying that recombinant protein behaves like native protein in membrane insertion assays

To address these challenges, researchers should consider using mild detergents for membrane protein extraction, including reducing agents in buffers to prevent unwanted disulfide formation, and performing functional assays promptly after purification to minimize storage-related artifacts.

How can researchers address inconsistencies in membrane insertion assays with recombinant CLIC1?

Inconsistencies in membrane insertion assays with recombinant CLIC1 can arise from several factors:

  • pH sensitivity: CLIC1 membrane insertion is strongly pH-dependent, with activity lowest around neutral pH and increasing in acidic conditions . Maintain precise pH control in all buffers.

  • Redox conditions: CLIC1 is redox-regulated . Standardize the redox environment using consistent concentrations of reducing/oxidizing agents.

  • Lipid composition: The membrane composition significantly affects CLIC1 insertion and channel properties. Use consistent lipid compositions with defined ratios of phospholipids and cholesterol.

  • Protein preparation: Variations in protein folding or oligomeric state affect insertion efficiency. Verify protein quality by size exclusion chromatography before membrane insertion experiments.

  • Temperature effects: Membrane fluidity varies with temperature, affecting insertion. Maintain constant temperature throughout experiments.

Warton et al. observed that CLIC1 insertion involves an initial small conductance with slow kinetics followed by high conductance fast kinetics, representing the final stage of membrane insertion and subsequent aggregation . Monitor these distinct phases to ensure consistent interpretation of results.

What controls are essential when studying the effects of recombinant pig CLIC1 in cellular systems?

When studying recombinant pig CLIC1 in cellular systems, several critical controls should be included:

  • Expression controls:

    • Empty vector controls to account for transfection/transduction effects

    • GFP-tagged constructs to confirm localization and expression levels

    • Western blotting to verify protein size and expression levels

  • Functional controls:

    • CLIC1 knockdown cells (via shRNA as described in Tung et al.)

    • Inactive mutants (e.g., cysteine mutants affecting redox sensitivity)

    • Channel blockers such as IAA-94 to confirm conductance is CLIC1-specific

  • Specificity controls:

    • Other CLIC family member expression to assess potential compensation

    • As demonstrated by Tung et al., immunoblotting for CLIC4 is important to verify that CLIC1 knockdown does not affect CLIC4 expression levels

  • Environmental controls:

    • pH standardization across experiments

    • Defined redox conditions

    • Consistent extracellular matrix components for migration/angiogenesis assays

What are promising areas for future research on pig CLIC1 in vascular biology?

Building on findings from human CLIC1 studies, several promising research directions for pig CLIC1 in vascular biology emerge:

  • Angiogenesis regulation: Human CLIC1 studies show it functions in endothelial cell growth and angiogenesis . Investigating pig CLIC1's role in species-specific vascular development could reveal evolutionary conservation of these pathways.

  • Integrin regulation: CLIC1 has been shown to regulate cell surface expression of various integrins including β1, α3, αVβ3, and αVβ5, which are critical for angiogenesis . Research could explore if pig CLIC1 has similar effects on integrin expression and how this mediates endothelial cell behavior.

  • Branching morphogenesis: Human CLIC1 knockdown inhibits endothelial network formation and branching . Comparative studies could determine if pig CLIC1 functions similarly in branching morphogenesis, potentially leading to insights for tissue engineering applications.

  • Mechanistic studies: Further exploration of how CLIC1 mediates these diverse endothelial behaviors would be valuable. As noted by Tung et al., "it will be important to understand the molecular mechanisms by which CLIC1 functions in these diverse endothelial cell behaviors" .

How might recombinant pig CLIC1 be utilized in comparative studies with human CLIC1 for drug development?

Recombinant pig CLIC1 offers valuable opportunities for comparative studies with human CLIC1 in drug development:

  • Structural comparison: Identifying conserved and divergent domains between species can highlight functionally critical regions that should be targeted by drugs.

  • Binding site conservation: Comparing binding characteristics of inhibitors or modulators between pig and human CLIC1 can predict cross-species efficacy of therapeutic compounds.

  • Functional conservation: Assessing whether pig CLIC1 exhibits the same channel properties, redox sensitivity, and pH dependence as human CLIC1 can validate pig models for preclinical studies.

  • Species-specific differences: Identifying any functional differences between pig and human CLIC1 can help predict potential limitations in translating results from preclinical pig models to human applications.

  • Compound screening: Using both pig and human CLIC1 in parallel screening assays can identify compounds with consistent effects across species, potentially improving translation to clinical applications.

What potential exists for using recombinant pig CLIC1 in studies of macrophage function and immunology?

The potential for using recombinant pig CLIC1 in immunological research is substantial, based on findings with human CLIC1:

  • Phagosome acidification: Human CLIC1 promotes phagosome acidification in macrophages, reducing pH from 4.4 to 3.4 . Studies comparing pig CLIC1's role in this process could reveal evolutionary conservation of this function.

  • NADPH oxidase interaction: Human CLIC1 colocalizes with the NADPH oxidase complex subunit Rac2 in activated macrophages . Research could investigate if pig CLIC1 similarly interacts with NADPH oxidase and regulates reactive oxygen species production.

  • Inflammasome regulation: Human CLIC1 contributes to inflammasome formation by modulating the NLRP3 complex . Comparative studies could determine if pig CLIC1 plays a similar role in regulating innate immune responses.

  • Antigen presentation: Macrophages lacking CLIC1 show impaired phagosome proteolysis and altered ability to kill microorganisms and expose antigens to T cells . Investigating whether pig CLIC1 functions similarly could provide insights for vaccine development strategies.

  • Species-specific immune differences: Identifying any differences in how pig CLIC1 functions in immune cells compared to human CLIC1 could inform the development of improved pig models for human immunological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.