Recombinant Pig Cholesterol 25-hydroxylase (CH25H)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Cholesterol 25-hydroxylase

Cholesterol 25-hydroxylase is an enzyme that catalyzes the conversion of cholesterol to 25-hydroxycholesterol (25HC), a potent regulator of lipid metabolism. The recombinant form of pig CH25H refers to the artificially produced version of this enzyme through genetic engineering techniques, enabling detailed study of its properties and functions. CH25H has been identified as a host restriction factor that exerts antiviral effects through multiple mechanisms, including the production of 25HC and direct interaction with viral proteins . This enzyme can be rapidly induced upon viral infections, suggesting its important role in innate immune responses against pathogens.

CH25H is highly expressed in porcine alveolar macrophages (PAMs), which are primary target cells for Porcine Reproductive and Respiratory Syndrome Virus (PRRSV) infection . This localization highlights the potential evolutionary significance of CH25H in protecting against respiratory viral infections in pigs.

Molecular Structure and Biochemical Function

Pig CH25H is a membrane-bound enzyme associated with the endoplasmic reticulum. Its catalytic activity depends on clusters of histidine residues that are essential for its function. The enzyme uses di-iron-oxygen as a cofactor to catalyze the hydroxylation of hydrophobic substrates, particularly cholesterol . This hydroxylation reaction produces 25-hydroxycholesterol, which serves as both a regulator of lipid metabolism and a potent antiviral molecule.

The recombinant form maintains the structural and functional characteristics of the native enzyme while allowing for controlled expression and purification. Understanding the molecular structure of CH25H has been crucial for elucidating its dual functions in metabolism and antiviral defense mechanisms.

Expression Patterns and Regulation

CH25H expression varies significantly across different porcine tissues and cell types. Research has demonstrated that CH25H expression is notably higher in porcine alveolar macrophages compared to other cell types such as PK-15 CD163 cells (a pig kidney cell line) . This differential expression pattern suggests tissue-specific regulation of this enzyme.

Intriguingly, PRRSV infection significantly downregulates CH25H expression in cells through currently unknown mechanisms. This downregulation occurs at both the mRNA and protein levels in a dose-dependent manner . The suppression of CH25H by PRRSV represents a potential viral evasion strategy to counteract host defense mechanisms.

Table 1: Comparative CH25H Expression in Different Cell Types

Cell TypeRelative CH25H ExpressionEffect of PRRSV Infection
Porcine Alveolar MacrophagesHighSignificant downregulation
PK-15 CD163 cellsMediumSignificant downregulation
MARC-145 cellsLowNot detected

Impact on PRRSV Replication

Studies have confirmed the significant antiviral activity of recombinant pig CH25H against PRRSV, one of the most economically important swine pathogens worldwide. Experimental evidence shows that overexpression of CH25H inhibits PRRSV replication, while knockdown of CH25H by short interfering RNA (siRNA) promotes viral infection . This bidirectional manipulation of CH25H levels clearly demonstrates its role as an antiviral factor.

When CH25H is overexpressed in MARC-145 cells or PAMs, PRRSV replication is significantly inhibited at multiple time points post-infection (12, 24, and 36 hours). Conversely, knockdown of CH25H promotes PRRSV replication and nsp2 (nonstructural protein 2) expression compared with control cells .

Table 2: Effect of CH25H Manipulation on PRRSV Replication

Experimental ConditionEffect on PRRSV ReplicationEffect on Viral Protein Expression
CH25H OverexpressionSignificant inhibitionDecreased nsp2 levels
CH25H KnockdownEnhanced replicationIncreased nsp2 levels
ControlBaseline replicationBaseline nsp2 levels

Hydroxylase-Dependent Inhibition Mechanism

The antiviral activity of CH25H operates partially through its enzymatic product, 25-hydroxycholesterol (25HC). Research indicates that 25HC specifically blocks PRRSV internalization but does not significantly affect virus attachment to cells . When examining the effect of 25HC on different stages of the PRRSV life cycle, experiments show that 25HC treatment prior to PRRSV infection does not significantly block virus attachment to PK-15 CD163 cells at various infection doses.

Table 3: Effect of 25HC on Different Stages of PRRSV Life Cycle

Stage of Viral Life CycleEffect of 25HC TreatmentReduction in Viral Titer
AttachmentNo significant inhibitionNone
Penetration/InternalizationSignificant inhibition~100-fold
ReplicationNo significant effectNone

Hydroxylase-Independent Inhibition Mechanism

One of the most remarkable aspects of CH25H's antiviral activity is its ability to inhibit PRRSV infection independently of its hydroxylase activity. A CH25H mutant (CH25H-M) lacking hydroxylase activity still demonstrated significant inhibition of PRRSV infection . This finding reveals a novel mechanism by which CH25H restricts virus replication beyond the production of 25HC.

Overexpression of CH25H-M significantly decreased PRRSV titers, RNA levels, and nsp2 expression at 12, 24, and 36 hours post-infection in both PAMs and MARC-145 cells . Further investigation using yeast two-hybrid screening followed by coimmunoprecipitation experiments revealed that both CH25H and CH25H-M interact with the nonstructural protein nsp1α of PRRSV .

This interaction leads to the degradation of nsp1α through the ubiquitin-proteasome pathway, with site K169 in the nsp1α protein identified as the key site of ubiquitination . This unexpected finding demonstrates that CH25H can directly target viral proteins for degradation, representing a novel antiviral mechanism distinct from its enzymatic production of 25HC.

Comparative Analysis with Other Species

While pig CH25H has been extensively studied in the context of PRRSV infection, it's valuable to compare it with CH25H from other species. Research has shown that the expression of CH25H is very low in human tissues compared to mice, suggesting potential differences in the evolutionary importance of this enzyme across species .

In humans, other enzymes such as cytochrome P450 family 3 subfamily A (CYP3A) also play significant roles in the production of 25-hydroxycholesterol. Studies have demonstrated that human CYP3A4 catalyzes not only 4β-hydroxylation but also 25-hydroxylation of cholesterol . Interestingly, the activity of cholesterol 25-hydroxylation by CYP3A4 was found to be higher than that of cholesterol 4β-hydroxylation .

These comparative differences highlight the importance of species-specific considerations when studying CH25H and its potential applications in research and therapeutic development.

Regulatory Role in Lipid Metabolism

Beyond its antiviral properties, CH25H plays an important role in lipid metabolism through the production of 25-hydroxycholesterol. 25HC is a potent regulator of lipid metabolism and has been widely used in in vitro experiments as an inhibitor of HMG-CoA reductase or as a ligand of LXRα .

Production of Recombinant CH25H for Research Applications

Recombinant pig CH25H can be produced using various expression systems, including bacterial, yeast, insect, and mammalian cell systems. For research purposes, CH25H has been expressed in cell lines such as MARC-145 cells and PK-15 CD163 cells through plasmid transfection or lentivirus-mediated expression .

Lentiviral vectors expressing CH25H-mCherry fusion protein have been successfully used to transduce primary cells like PAMs, which typically have lower transfection efficiency with plasmid DNA . This approach allows for efficient expression and functional studies of recombinant CH25H in relevant cellular contexts.

Potential Therapeutic Applications

The antiviral properties of recombinant pig CH25H make it an attractive target for the development of anti-PRRSV therapeutics. PRRSV has been a continuous threat to the global swine industry, and current vaccines are insufficient to provide sustainable control . Understanding and potentially harnessing the antiviral mechanisms of CH25H could lead to novel therapeutic approaches.

The dual mechanisms of CH25H-mediated viral inhibition—both through 25HC production and direct targeting of viral proteins for degradation—provide multiple avenues for therapeutic development. Additionally, the observation that PRRSV actively decreases CH25H expression to promote viral replication highlights the complex interplay between virus and host, suggesting potential strategies to counteract viral evasion mechanisms .

Table 4: Mechanisms of PRRSV Inhibition by CH25H

MechanismMediatorTargetDependency on Hydroxylase Activity
Inhibition of viral penetration25HCViral internalizationDependent
Protein degradationCH25H/CH25H-Mnsp1α (site K169)Independent
UbiquitinationCH25H/CH25H-Mnsp1αIndependent

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CH25H; Cholesterol 25-hydroxylase; Cholesterol 25-monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
CH25H
Target Protein Sequence
MSGHNNSELFVLCSSSQLFLQPLWDHLKTWETLILSPFFPVFFSITTYLGFCLPFVVLDV LCPWVPALRRYKIHPDFSPSVWQLLPCLGLTLYQHVVFVFPMTLLHWAASPVLLPPEAPE LLQLVRHIVLCLLLFDTEFFIWHVLHHKVPWLYRTFHKMHHQNSSSFALATQYMSVGELL SLGVFDMVNIMLLRCHPLTVLIFHVINIWLSVEDHSGYDFPWSAHRLVPFGWYGGVTHHD LHHSQFNCNFAPYFTHWDKILGTLRSAHAK
Uniprot No.

Target Background

Function
Cholesterol 25-hydroxylase (CH25H) catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to the repression of cholesterol biosynthetic enzymes. It plays a critical role in cell positioning and movement in lymphoid tissues, as 25-hydroxycholesterol is an intermediate in the biosynthesis of 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC). This oxysterol acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for various lymphoid cells. CH25H may significantly regulate lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. As an interferon-stimulated gene, it exhibits broad antiviral activities against a wide range of enveloped viruses. Its product, 25-hydroxycholesterol, activates the ER-localized enzyme ACAT, inducing the internalization of accessible cholesterol on the plasma membrane and restricting virus-host membranes fusion, ultimately inhibiting viral replication. In the testis, the production of 25-hydroxycholesterol by macrophages plays a crucial role in Leydig cell differentiation.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Cholesterol 25-hydroxylase (CH25H) and what is its primary function?

Cholesterol 25-hydroxylase (CH25H) is an enzyme that catalyzes the oxidation of cholesterol to 25-hydroxycholesterol (25HC). It functions as a host restriction factor with significant antiviral properties. CH25H is a membrane-bound enzyme that plays a crucial role in sterol metabolism and innate immune response against viral infections. The protein contains catalytic domains responsible for the hydroxylation reaction, with histidine residues at positions 242 and 243 being essential for its enzymatic activity .

What are the key structural characteristics of recombinant pig CH25H?

Recombinant pig CH25H shares significant homology with human CH25H, which has a predicted molecular mass of approximately 36 kDa, though the accurate molecular mass after expression is typically around 31 kDa. The protein has an isoelectric point of approximately 8.3, indicating its slightly basic nature. The functional protein contains important transmembrane domains and a catalytic center with essential histidine residues. When these histidine residues at positions 242 and 243 are converted to glutamines through site-directed mutagenesis, the resulting mutant (CH25H-M) loses its catalytic activity while retaining some antiviral properties .

How does the enzymatic activity of CH25H differ between species?

While the search results don't directly compare CH25H enzymatic activity across species, they do indicate expression level differences in various cell types. For instance, CH25H expression is significantly higher in porcine alveolar macrophages (PAMs) compared to PK-15CD163 cells (pig kidney cell line), while MARC-145 cells (monkey kidney cell line) show minimal CH25H expression. These expression variations suggest potential species-specific differences in CH25H regulation and function. Research indicates that despite these differences, the core enzymatic function of converting cholesterol to 25HC appears conserved across mammalian species, though catalytic efficiency may vary .

What expression systems are most efficient for producing recombinant pig CH25H?

Based on commercial recombinant protein information, prokaryotic expression systems using E. coli are commonly employed for CH25H production. For research applications, the pCAGGS expression vector system has been successfully used for CH25H expression in mammalian cells. When expressing recombinant CH25H, it's important to consider that the full-length protein contains transmembrane domains that may complicate expression. Some approaches use partial protein expression (e.g., Trp142~Arg272 region with His and TRxA tags) to improve solubility and yield. For optimal expression, codon optimization for the host organism and temperature control during induction are critical factors .

What are the recommended purification protocols for recombinant pig CH25H?

While specific purification protocols for pig CH25H aren't detailed in the search results, standard approaches for membrane proteins with His-tags would apply. A typical purification workflow would include:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Initial clarification by centrifugation to remove cellular debris

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Optional on-column refolding if purified under denaturing conditions

  • Elution with imidazole gradient

  • Further purification using size exclusion chromatography

  • Buffer exchange to final storage buffer (typically PBS pH 7.4)

For research applications, achieving >95% purity is standard, with endotoxin levels maintained below 1.0 EU per 1μg protein when determined by the LAL method .

How should recombinant CH25H be stored to maintain its stability and activity?

For optimal stability, recombinant CH25H should be stored as follows:

  • Short-term storage (up to one month): 2-8°C in appropriate buffer

  • Long-term storage: Aliquot and store at -80°C for up to 12 months

  • Avoid repeated freeze/thaw cycles as they significantly reduce protein stability

  • When supplied as freeze-dried powder, reconstitute in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL

  • Do not vortex the reconstituted protein to avoid denaturation

  • For buffers, PBS (pH 7.4) containing 0.01% SKL and 5% trehalose helps maintain stability

Thermal stability testing shows that properly stored CH25H maintains stability with less than 5% degradation when incubated at 37°C for 48h .

Through what mechanisms does CH25H exhibit antiviral activity against coronaviruses?

CH25H exerts antiviral effects against coronaviruses through multiple mechanisms:

  • Production of 25HC: The primary mechanism involves the enzymatic conversion of cholesterol to 25HC, which blocks viral entry by interfering with membrane fusion events.

  • Inhibition of viral penetration: 25HC specifically targets the viral entry phase, preventing viral fusion with host cell membranes and subsequent viral genome release.

  • Hydroxylase-independent mechanisms: Interestingly, mutant CH25H lacking hydroxylase activity (CH25H-M) still exhibits antiviral effects against PEDV, albeit to a lesser extent than wild-type CH25H, suggesting additional antiviral mechanisms beyond 25HC production.

  • Regulation of lipid metabolism: 25HC suppresses cholesterol biosynthesis by repressing the activation of sterol regulatory element-binding proteins (SREBPs), which may create a cellular environment less favorable for viral replication.

  • SREBP pathway modulation: 25HC accelerates the retention of the SREBP–SCAP complex in the endoplasmic reticulum through overexpression of insulin-induced genes (INSIGs), controlling the sterol biosynthesis pathway .

What is the comparative efficacy of CH25H against different porcine coronaviruses?

Research demonstrates that CH25H and its product 25HC have broad-spectrum antiviral activity against multiple porcine coronaviruses:

VirusCH25H Overexpression Inhibition25HC Treatment InhibitionKey Findings
PEDVSignificant reduction in viral titers and N protein levelsDose-dependent inhibition at viral entry phaseBoth wild-type CH25H and CH25H-M (mutant) show antiviral activity
TGEVSignificant suppression of viral replicationEffective inhibition at 10 μM concentrationSimilar mechanism as for PEDV, blocking viral entry
PRRSVDownregulates CH25H expressionInhibits viral penetrationCH25H additionally degrades viral protein through the ubiquitin-proteasome pathway

This broad-spectrum activity suggests CH25H and 25HC target conserved mechanisms in the coronavirus replication cycle, making them promising candidates for antiviral development .

How does viral infection affect the expression and regulation of CH25H?

Viral infections have been shown to significantly modulate CH25H expression in host cells:

  • Downregulation by PEDV and PRRSV: Both viruses actively suppress CH25H expression in infected cells in a time-dependent and dose-dependent manner. This suggests a viral evasion strategy to counteract the antiviral effects of CH25H.

  • Cell-type dependent expression: CH25H expression varies significantly across cell types, with high expression in porcine alveolar macrophages (PAMs), intermediate expression in PK-15CD163 cells, and low expression in MARC-145 cells. This cell-type specificity may influence susceptibility to viral infection.

  • Transcriptional regulation: PEDV infection downregulates CH25H at both mRNA and protein levels, indicating transcriptional or post-transcriptional mechanisms of suppression.

  • Interferon relationship: While CH25H is typically considered an interferon-stimulated gene (ISG), the research indicates it is not an ISG in Vero cells, suggesting cell-type specific regulation patterns for CH25H expression .

What are the recommended protocols for studying CH25H-mediated viral inhibition?

For investigating CH25H-mediated viral inhibition, researchers should consider the following protocols:

  • Overexpression studies:

    • Transfect cells with pCAGGS-CH25H-Flag expression vector (1 μg per well in 24-well plates)

    • Use Lipmax or similar transfection reagent following manufacturer's protocol

    • Include pCAGGS empty vector as control

    • After 24-48 hours post-transfection, infect with virus

    • Analyze viral replication by western blotting, qRT-PCR, and immunofluorescence assay

  • Knockdown experiments:

    • Design siRNAs targeting CH25H (at least three different sequences)

    • Transfect cells with siRNAs using Lipofectamine RNAiMAX

    • Include negative control siRNA

    • Confirm knockdown efficiency by qRT-PCR at 48h post-transfection

    • Proceed with viral infection and analysis

  • 25HC treatment assays:

    • Pretreat cells with various concentrations of 25HC (usually 1-10 μM)

    • Include ethanol (Et) vehicle control

    • After 1 hour pretreatment, infect with virus

    • Evaluate viral replication by TCID50, western blotting, and qRT-PCR

How can researchers accurately measure the enzymatic activity of CH25H?

To accurately measure CH25H enzymatic activity, researchers should:

  • Direct measurement of 25HC production:

    • Extract total lipids from CH25H-expressing cells or reaction mixtures

    • Perform liquid chromatography-mass spectrometry (LC-MS) to quantify 25HC levels

    • Include appropriate standards and controls

  • Enzyme kinetics assay:

    • Prepare purified recombinant CH25H or membrane fractions from expressing cells

    • Add radiolabeled or fluorescently-labeled cholesterol substrate

    • Measure 25HC formation over time under optimal pH and temperature conditions

    • Calculate enzymatic parameters (Km, Vmax)

  • Indirect assays:

    • Monitor downstream effects of 25HC on SREBP cleavage by western blotting

    • Assess changes in cholesterol biosynthesis genes using qRT-PCR

    • Measure antiviral activity as a proxy for enzymatic function

  • Mutational analysis:

    • Compare wild-type CH25H with mutants (e.g., H242Q/H243Q) that lack hydroxylase activity

    • Quantify differences in 25HC production and antiviral efficacy

What cell models are most appropriate for studying CH25H function in the context of viral infections?

Based on the research findings, the following cell models are appropriate for studying CH25H function in viral infections:

  • Porcine Alveolar Macrophages (PAMs):

    • Primary cells with naturally high CH25H expression

    • Physiologically relevant for respiratory viruses

    • Suitable for studying natural CH25H regulation and function

    • Challenges include limited availability and batch variation

  • PK-15CD163 cells:

    • Pig kidney cell line stably expressing CD163 (PRRSV receptor)

    • Intermediate CH25H expression

    • Good model for studying both PRRSV and PEDV infections

    • More homogeneous than primary cells

  • Vero cells:

    • Commonly used for PEDV propagation and studies

    • CH25H is not an interferon-stimulated gene in these cells

    • Useful for studying CH25H overexpression effects

  • ST cells (Swine Testis):

    • Suitable for TGEV infection studies

    • Allow for comparative analysis of CH25H effects across different coronaviruses

Selection criteria should consider the virus being studied, the specific aspect of CH25H function under investigation, and the endogenous expression level of CH25H in the cell model .

How might CH25H be leveraged for development of antiviral strategies against coronaviruses?

CH25H offers several promising avenues for antiviral development against coronaviruses:

  • 25HC-based therapeutics:

    • Direct administration of 25HC or stable derivatives as antiviral agents

    • Development of 25HC analogs with enhanced stability and reduced off-target effects

    • Formulation strategies to improve delivery to sites of viral infection

  • CH25H expression modulation:

    • Identification of compounds that upregulate endogenous CH25H expression

    • Gene therapy approaches to increase CH25H expression in target tissues

    • Counteracting viral mechanisms that downregulate CH25H

  • Combination therapies:

    • Pairing 25HC with other antivirals targeting different viral replication stages

    • Combining CH25H-based approaches with immune modulators

    • Synergistic effects with vaccines to enhance protection

  • Broad-spectrum applications:

    • Leveraging the activity against multiple coronaviruses for pan-coronavirus strategies

    • Extending research to other enveloped viruses potentially affected by sterol metabolism

  • Prevention strategies:

    • Prophylactic administration of 25HC or inducers in high-risk settings

    • Development of CH25H-based viral inhibitors for surface disinfection

What are the mechanisms behind viral counteraction of CH25H restriction?

The observed downregulation of CH25H during viral infection suggests sophisticated viral evasion strategies:

  • Transcriptional suppression:

    • PEDV and PRRSV infections significantly reduce CH25H mRNA levels

    • This may involve viral interference with transcription factors that regulate CH25H expression

    • Potential targeting of interferon regulatory pathways that normally induce CH25H

  • Post-transcriptional regulation:

    • Viruses may accelerate CH25H mRNA degradation

    • Possible viral targeting of microRNAs that regulate CH25H expression

  • Protein-level mechanisms:

    • Direct degradation of CH25H protein through virus-induced proteasomal pathways

    • Viral proteins may interact with CH25H to inhibit its enzymatic activity

    • Sequestration of CH25H away from sites of viral replication

  • Countering 25HC effects:

    • Viral adaptations to membrane composition that reduce sensitivity to 25HC

    • Alternative entry pathways less affected by 25HC-mediated inhibition

Understanding these viral evasion mechanisms could inform strategies to restore CH25H-mediated restriction as an antiviral approach .

What are the potential off-target effects of CH25H overexpression or 25HC administration in experimental systems?

Researchers should be aware of potential off-target effects when working with CH25H or 25HC:

What are common challenges in expressing and purifying functional CH25H?

Researchers frequently encounter several challenges when working with CH25H:

  • Membrane protein expression difficulties:

    • CH25H is a membrane-bound protein, making soluble expression challenging

    • Often forms inclusion bodies in prokaryotic expression systems

    • May require detergent solubilization or specialized membrane protein expression systems

  • Maintaining enzymatic activity:

    • The catalytic activity depends on proper folding and appropriate redox environment

    • Critical histidine residues (positions 242 and 243) must be maintained in proper orientation

    • Activity can be lost during purification steps

  • Low yield issues:

    • Expression levels may be low compared to cytosolic proteins

    • Partial protein domains (e.g., Trp142~Arg272) may be used to improve yields

    • Addition of tags like His and TRxA can improve solubility but may affect activity

  • Potential solutions:

    • Consider cell-free expression systems for membrane proteins

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Use mild detergents for extraction while maintaining protein structure

    • Explore nanodiscs or liposome reconstitution for functional studies

How can researchers effectively control for hydroxylase-dependent versus hydroxylase-independent effects?

To distinguish between hydroxylase-dependent and independent effects of CH25H:

  • Parallel experimental approaches:

    • Compare wild-type CH25H with hydroxylase-inactive mutant CH25H-M (H242Q/H243Q)

    • Direct 25HC treatment versus CH25H overexpression

    • Combined approaches using CH25H-M with exogenous 25HC supplementation

  • Mechanistic controls:

    • Measure 25HC production to confirm hydroxylase activity or its absence

    • Monitor downstream effects on SREBP cleavage as indicator of 25HC presence

    • Assess changes in cholesterol biosynthesis genes by qRT-PCR

  • Experimental design considerations:

    • Include both vector control and CH25H-M in overexpression studies

    • For 25HC treatments, use appropriate vehicle controls (e.g., ethanol)

    • Consider concentration ranges to distinguish threshold effects

  • Advanced approaches:

    • Use CRISPR/Cas9 to generate CH25H knockout cells, then complement with wild-type or mutant CH25H

    • Employ targeted lipidomics to comprehensively assess sterol changes

    • Utilize protein-protein interaction studies to identify hydroxylase-independent binding partners

What quality control measures should be implemented when working with recombinant CH25H?

To ensure reproducible results with recombinant CH25H, implement these quality control measures:

  • Protein purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (target >95% purity)

    • Western blotting with specific antibodies against CH25H and tag epitopes

    • Mass spectrometry confirmation of protein identity

  • Functional verification:

    • Enzymatic activity assay measuring conversion of cholesterol to 25HC

    • Antiviral activity testing in appropriate cell models

    • Structure verification through circular dichroism or other spectroscopic methods

  • Contamination screening:

    • Endotoxin testing using LAL method (target <1.0EU per 1μg)

    • Mycoplasma testing of expression systems

    • Sterility checks for final protein preparation

  • Stability monitoring:

    • Accelerated degradation testing at 37°C for 48h

    • Regular activity testing of stored samples

    • Size exclusion chromatography to detect aggregation

  • Batch consistency:

    • Maintain detailed records of expression conditions

    • Standardize purification protocols

    • Compare new batches against reference standards for critical parameters

  • Storage validation:

    • Confirm activity retention after freeze-thaw cycles

    • Validate long-term storage conditions at -80°C

    • Test stabilizing additives like trehalose for lyophilized preparations

What are the current knowledge gaps in understanding CH25H-mediated antiviral mechanisms?

Despite significant progress, several knowledge gaps remain in understanding CH25H's antiviral functions:

  • Structural interactions:

    • Precise molecular mechanism by which 25HC blocks viral fusion

    • Structural basis for hydroxylase-independent antiviral activities

    • Potential direct interactions between CH25H and viral proteins

  • Regulatory networks:

    • Complete characterization of factors controlling CH25H expression in different tissues

    • Understanding species-specific differences in CH25H regulation

    • Mechanism by which viruses suppress CH25H expression

  • Enzymatic aspects:

    • Rate-limiting steps in the catalytic conversion of cholesterol to 25HC

    • Potential alternate substrates or products of CH25H

    • Regulatory post-translational modifications affecting enzymatic activity

  • Physiological context:

    • In vivo relevance of CH25H-mediated restriction during natural infections

    • Tissue-specific variations in CH25H antiviral activity

    • Impact of CH25H polymorphisms on susceptibility to viral infections

  • Therapeutic development:

    • Optimal formulation strategies for 25HC-based therapeutics

    • Structure-activity relationships for improved 25HC analogs

    • Potential resistance mechanisms that might emerge against CH25H-based interventions

How does CH25H function interact with other innate immune pathways during viral infection?

CH25H functions within a complex network of innate immune responses:

What opportunities exist for developing CH25H-based strategies against emerging coronaviruses?

The broad-spectrum activity of CH25H against multiple coronaviruses presents several opportunities:

  • Prophylactic applications:

    • Development of stable 25HC formulations for high-risk settings

    • Identification of small molecules that upregulate endogenous CH25H

    • Design of inhaled 25HC derivatives for respiratory protection

  • Therapeutic advancements:

    • Creation of 25HC analogs with enhanced pharmacokinetic properties

    • Combination approaches with direct-acting antivirals

    • Targeted delivery systems to increase concentration at sites of viral replication

  • Diagnostic potential:

    • CH25H expression levels as biomarkers for infection susceptibility

    • 25HC levels as indicators of disease progression

    • Genetic screening for CH25H variants related to coronavirus susceptibility

  • Cross-species protection:

    • Leveraging the conserved antiviral mechanism for broad protection against zoonotic coronaviruses

    • Identifying species variations in CH25H that confer resistance

    • Applying findings from animal coronaviruses to human pathogens

  • Pandemic preparedness:

    • Development of 25HC-based countermeasures as part of pandemic stockpiles

    • Pre-clinical validation against diverse coronavirus strains

    • Standardized production methods for rapid scale-up during outbreaks

Future research should focus on optimizing delivery methods, enhancing potency, and establishing in vivo efficacy models for CH25H-based interventions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.