Recombinant Pig CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 (ST3GAL1)

Shipped with Ice Packs
In Stock

Description

Research Applications and Assays

This recombinant enzyme is pivotal in glycobiology studies:

Key Applications

  • Glycan Profiling: Used to sialylate synthetic substrates like asialofetuin or GM1a gangliosides .

  • Immune Regulation: Investigates CD8+ T-cell survival mechanisms via sialylation of CD43 and CD45 .

  • Biomarker Development: Quantified in biological samples using ELISA (e.g., Krishgen GENLISA kit) .

Validation Assays

  • Activity Assays: Measure transfer efficiency using fluorescently labeled CMP-sialic acid .

  • Analytical Range: Linear NPX values between 1–100 ng/mL in plasma/serum .

Pathway Involvement

Recombinant pig ST3GAL1 participates in conserved metabolic pathways:

PathwayRole
Mucin-type O-Glycan BiosynthesisAdds terminal sialic acid to core 1 structures (Galβ1-3GalNAc-O-Ser/Thr)
Ganglioside BiosynthesisConverts GM1a to GD1a, influencing neuronal signaling
Immune RegulationModulates T-cell glycoprotein sialylation to prevent apoptosis

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

  • Interfering Factors: Hemolysis or hyperlipidemia in samples may skew ELISA results .

  • Cross-Reactivity: Antibodies for pig ST3GAL1 show specificity within Suidae family members .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ST3GAL1; SIAT4A; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1; Alpha 2,3-ST 1; Beta-galactoside alpha-2,3-sialyltransferase 1; Gal-NAc6S; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; Monosialoganglioside sialyltransferase; ST3Gal I; ST3GalI; ST3GalA.1; ST3O; Sialyltransferase 4A; SIAT4-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
ST3GAL1
Target Protein Sequence
MAPMRKKSTLKLLTLLVLFIFLTSFFLNYSHTVVTTAWFPKQMVIELSENFKKLMKYPYRPCTCTRCIEEQRVSAWFDERFNRSMQPLLTAKNAHLEEDTYKWWLRLQREKQPNNLNDTIRELFQVVPGNVDPLLEKRLVSCRRCAVVGNSGNLKESYYGPQIDSHDFVLRMNKAPTEGFEADVGSKTTHHFVYPESFRELAQEVSMILVPFKTTDLEWVISATTTGRISHTYVPVPAKIKVKKEKILIYHPAFIKYVFDRWLQGHGRYPSTGILSVIFSLHICDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDGDFESNVTTILASINKIRIFKGR
Uniprot No.

Target Background

Function
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 (ST3GAL1) is a beta-galactoside alpha2-3 sialyltransferase involved in the terminal sialylation of glycoproteins and glycolipids. It catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc-terminated glycoconjugates through an alpha2-3 linkage. This enzyme adds sialic acid to the core 1 O-glycan, Galbeta-(1->3)-GalNAc-O-Ser/Thr, which is a major structure of mucin-type O-glycans. As part of a homeostatic mechanism regulating CD8-positive T cell numbers, ST3GAL1 sialylates core 1 O-glycans of T cell glycoproteins, SPN/CD43 and PTPRC/CD45. It prevents premature apoptosis of thymic CD8-positive T cells prior to peripheral emigration, while in the secondary lymphoid organs, it controls the survival of CD8-positive memory T cells generated following a successful immune response. ST3GAL1 also transfers sialic acid to asialofetuin, presumably onto Galbeta-(1->3)-GalNAc-O-Ser. Furthermore, it sialylates GM1a, GA1 and GD1b gangliosides to form GD1a, GM1b and GT1b, respectively.
Gene References Into Functions
  1. These results identified the core promoter region in the pST3Gal I promoter and demonstrated that Smad-3 binding to the Samd-3 binding site at -1020 is essential for transcriptional activation of pST3Gal I in TGF-beta1-induced PK-15 cells. PMID: 21945615
Database Links
Protein Families
Glycosyltransferase 29 family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type II membrane protein. Secreted.
Tissue Specificity
The long isoform is abundant in salivary gland, liver, lung, and colon mucosa. Both long and short forms are detected in submaxillary salivary glands.

Q&A

What is the molecular structure and primary function of porcine ST3GAL1?

Porcine ST3GAL1 (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1) belongs to the sialyltransferase family responsible for terminal sialylation of glycoproteins and glycolipids. This enzyme specifically catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc-terminated glycoconjugates through an alpha2-3 linkage . The primary function involves adding sialic acid to the core 1 O-glycan, Galbeta-(1->3)-GalNAc-O-Ser/Thr, which constitutes a major structure of mucin-type O-glycans . The enzyme shares structural similarities with mammalian homologs, containing conserved sialylmotifs necessary for substrate binding and catalytic activity.

ST3GAL1 contains distinct structural domains: a short N-terminal cytoplasmic domain, a transmembrane domain, a stem region, and a catalytic domain housing the active site. The catalytic domain contains four highly conserved sialylmotifs (L, S, III, and VS) that are essential for enzyme activity, substrate binding, and catalysis. The crystallographic structure reveals a Rossmann-like fold typical of glycosyltransferases, with specific binding pockets for the donor CMP-Neu5Ac and the acceptor glycan.

How does porcine ST3GAL1 compare structurally and functionally to human ST3GAL1?

Porcine ST3GAL1 shares significant sequence homology with human ST3GAL1, with conserved catalytic domains and substrate recognition sites. Based on comparative analysis of available sequences, both enzymes perform analogous functions in their respective species, catalyzing the transfer of sialic acid to Galbeta-(1->3)-GalNAc structures . Human ST3GAL1 has been more extensively characterized and has well-documented roles in T cell homeostasis, preventing premature apoptosis of thymic CD8-positive T cells and controlling CD8-positive memory T cell survival in secondary lymphoid organs .

Similar to its human counterpart, porcine ST3GAL1 can sialylate gangliosides including GM1a, GA1, and GD1b to form GD1a, GM1b, and GT1b, respectively . Both enzymes also transfer sialic acid to asialofetuin, presumably onto Galbeta-(1->3)-GalNAc-O-Ser structures . Despite these similarities, species-specific differences may exist in substrate preferences, kinetic parameters, and regulatory mechanisms, which warrant further comparative studies.

What are the expression patterns of ST3GAL1 in various porcine tissues under normal and pathological conditions?

Under normal physiological conditions, ST3GAL1 demonstrates differential expression across porcine tissues, with notable presence in immune-related tissues, liver, and kidney. While comprehensive tissue-specific expression profiles for pig ST3GAL1 are still emerging, studies indicate that this enzyme may be upregulated during inflammatory and infectious conditions .

Research on Trypanosoma brucei brucei infection in pigs has shown significant upregulation of ST3GAL1 gene expression in liver and kidney tissues. Quantitative real-time PCR analysis revealed 5-42 fold increases in ST3GAL1 expression in infected pigs compared to non-infected controls (p < 0.0001) . This substantial upregulation suggests ST3GAL1 plays a crucial role in the host response to trypanosomal infection, potentially through mechanisms involving resialylation of red blood cells or modulation of immune cell function.

The tissue-specific regulation of ST3GAL1 appears to be governed by both developmental programming and responsive elements that react to pathological states. During infection, the enzyme's elevated expression may represent an adaptive response aimed at compensating for parasite-induced desialylation of host cells or modulation of immune receptor glycosylation patterns.

What expression systems yield optimal activity for recombinant pig ST3GAL1 production?

Several expression systems have been employed for recombinant production of mammalian sialyltransferases, with varying degrees of success for porcine ST3GAL1. The choice of expression system significantly impacts enzyme yield, activity, and glycosylation pattern. Mammalian expression systems, particularly Chinese Hamster Ovary (CHO) and Human Embryonic Kidney 293 (HEK293) cells, generally produce ST3GAL1 with glycosylation patterns and activity profiles most closely resembling the native enzyme.

For functional studies requiring high purity, a truncated form of porcine ST3GAL1 lacking the transmembrane domain but retaining the catalytic region can be expressed with a secretion signal and affinity tag. This approach facilitates secretion into culture medium and subsequent purification. Baculovirus-insect cell systems (Sf9 or High Five cells) offer a compromise between proper eukaryotic post-translational modifications and higher expression levels compared to mammalian systems.

Bacterial systems like Escherichia coli can produce non-glycosylated enzyme but often yield inclusion bodies requiring refolding protocols, which may result in lower specific activity. Yeast systems (Pichia pastoris or Saccharomyces cerevisiae) provide intermediate solutions with some eukaryotic processing capabilities and higher yields than mammalian cells.

The optimal expression construct design includes:

  • Codon optimization for the host organism

  • N-terminal secretion signal (if secreted form is desired)

  • C-terminal affinity tag (His6 or Fc) for purification

  • Removal of transmembrane domain for soluble expression

  • Retention of stem region for proper folding

How can researchers assess and optimize the enzyme kinetics of recombinant pig ST3GAL1?

Comprehensive enzyme kinetic analysis of recombinant pig ST3GAL1 requires systematic evaluation of both donor and acceptor substrate parameters. Standard in vitro assays employ radiochemical, fluorescent, or coupled enzymatic methods to monitor sialic acid transfer rates.

For detailed kinetic characterization, researchers should determine the following parameters using varied concentrations of substrates:

  • Km and Vmax for CMP-Neu5Ac donor

  • Km and Vmax for various acceptor substrates

  • pH optimum (typically 6.0-7.0 for sialyltransferases)

  • Temperature stability and activity profile

  • Metal ion requirements (typically Mn2+ or Mg2+)

  • Inhibition constants for product and substrate inhibition

A representative kinetic data table for recombinant pig ST3GAL1 with various substrates might appear as follows:

SubstrateKm (μM)Vmax (nmol/min/mg)kcat (s-1)kcat/Km (M-1s-1)
CMP-Neu5Ac25-403.5-5.02.1-3.07.0-9.0 × 104
Gal-β-1,3-GalNAc-α-O-Bn80-1203.0-4.51.8-2.72.0-2.5 × 104
Asialofetuin2-52.5-3.51.5-2.15.0-8.0 × 105
GM1a10-252.0-3.01.2-1.86.0-9.0 × 104

Optimizing reaction conditions requires systematic variation of buffer components, pH, temperature, and cofactors. The presence of divalent cations, particularly Mn2+ at 5-20 mM, typically enhances ST3GAL1 activity. Addition of non-ionic detergents (0.05-0.1% Triton X-100) may improve enzyme stability and activity for membrane-associated forms of the enzyme.

What strategies are effective for creating and validating ST3GAL1 knockout or knockdown models in porcine cells?

Developing ST3GAL1-deficient porcine models provides valuable insights into enzyme function. CRISPR-Cas9 gene editing has emerged as the preferred approach for generating precise modifications in the porcine ST3GAL1 gene. The technique has been successfully applied to create knockout models for related genes in pigs, as demonstrated by the generation of CMP-Neu5Ac hydroxylase (CMAH) knockout pigs .

For CRISPR-Cas9 targeting of porcine ST3GAL1, researchers should:

  • Design guide RNAs targeting early exons or catalytic domains

  • Validate guide RNA efficiency in porcine cell lines

  • Create targeting constructs with appropriate selection markers

  • Perform gene editing in porcine primary cells or embryos

  • Verify modifications through sequencing and functional assays

Validation of ST3GAL1 knockout should include:

  • Genomic verification (PCR, sequencing)

  • Transcript analysis (RT-PCR, RNA-Seq)

  • Protein expression analysis (Western blot)

  • Enzymatic activity assays

  • Glycan profile analysis (lectin staining, mass spectrometry)

  • Phenotypic characterization (cellular and systemic)

Alternative approaches include RNA interference (RNAi) for transient knockdown studies, which may be particularly useful for initial characterization before undertaking complete knockout generation. Antisense oligonucleotides or inducible shRNA systems offer temporal control over ST3GAL1 expression, allowing for developmental stage-specific analysis.

How does ST3GAL1 activity influence immune function in porcine models?

ST3GAL1 plays a critical role in porcine immune function through the sialylation of glycoproteins on immune cells. Similar to observations in human systems, porcine ST3GAL1 likely contributes to T cell homeostasis by sialylating core 1 O-glycans on T cell glycoproteins such as CD43 and CD45 . This sialylation is part of a regulatory mechanism that prevents premature apoptosis of thymic CD8-positive T cells and controls the survival of CD8-positive memory T cells in secondary lymphoid organs .

During infection with pathogens like Trypanosoma brucei brucei, significant upregulation of ST3GAL1 occurs in porcine tissues. Studies have documented 5-42 fold increases in ST3GAL1 expression in liver and kidney tissues of infected pigs compared to non-infected controls . This dramatic increase suggests that ST3GAL1 upregulation represents an important host response mechanism, potentially aimed at:

  • Compensating for parasite-induced desialylation of host cells

  • Modifying immune receptor glycosylation to enhance pathogen recognition

  • Altering cell surface sialylation to regulate immune cell activation and trafficking

  • Participating in the resialylation of red blood cells to mitigate anemia

Researchers investigating ST3GAL1's immune functions should consider:

  • Flow cytometric analysis of immune cell surface sialylation

  • Lectin binding assays to profile specific sialic acid linkages

  • Functional immune assays comparing wild-type and ST3GAL1-deficient cells

  • Infection models to assess infection susceptibility in ST3GAL1 knockout or overexpression systems

What are the most reliable methods for measuring ST3GAL1 enzymatic activity in porcine tissue samples?

Quantifying ST3GAL1 activity in porcine tissue samples requires selective and sensitive methods that can distinguish its activity from other sialyltransferases. Several complementary approaches are recommended for comprehensive analysis.

Radiochemical assays using CMP-[14C]Neu5Ac or CMP-[3H]Neu5Ac as donors provide high sensitivity and specificity. In this approach, the transfer of radioactive sialic acid to acceptor substrates (Gal-β-1,3-GalNAc-terminated glycans) is measured, followed by separation of products using ion-exchange chromatography, paper chromatography, or gel filtration. While highly quantitative, these methods require specialized facilities for handling radioactive materials.

Fluorescence-based assays utilizing derivatized sialic acid donors offer non-radioactive alternatives with good sensitivity. For example, CMP-9-fluoresceinyl-Neu5Ac allows for direct fluorometric detection of sialylated products. High-performance liquid chromatography (HPLC) or capillary electrophoresis methods can separate and quantify sialylated products with high resolution.

Mass spectrometry-based methods provide detailed structural information about sialylated products. Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) or electrospray ionization mass spectrometry (ESI-MS) can characterize sialylated glycans from reaction mixtures or directly from tissue samples.

Immunological methods using antibodies specific for α2,3-linked sialic acids can be employed for tissue section analysis or cell surface sialylation studies. Lectin-based assays using Maackia amurensis lectin II (MAL-II), which specifically recognizes α2,3-linked sialic acids, provide a simple approach for detecting ST3GAL1 products in tissue samples or on glycoproteins.

How can researchers distinguish ST3GAL1 activity from other sialyltransferases in experimental systems?

Distinguishing ST3GAL1 activity from other sialyltransferases in porcine experimental systems requires careful selection of substrate specificities and inhibitor profiles. ST3GAL1 preferentially transfers sialic acid to Gal-β-1,3-GalNAc structures (core 1 O-glycans) through an α2,3 linkage, while other sialyltransferases have different acceptor preferences .

Substrate specificity profiling represents the most reliable approach for distinguishing ST3GAL1 activity. The enzyme demonstrates high activity toward:

  • Core 1 O-glycan structures (Gal-β-1,3-GalNAc-α-O-Ser/Thr)

  • Asialofetuin (containing Gal-β-1,3-GalNAc structures)

  • GM1a, GA1, and GD1b gangliosides

In contrast, ST3GAL1 shows limited activity toward:

  • Type 2 chains (Gal-β-1,4-GlcNAc)

  • Type 3 chains (Gal-β-1,3-GlcNAc)

  • Lactosamine structures

Researchers can employ specific inhibitors to differentiate sialyltransferase activities. CMP serves as a competitive inhibitor for all sialyltransferases, while lithium chloride at specific concentrations can differentially inhibit ST3GAL family members. Additionally, developing ST3GAL1-specific antibodies allows for immunodepletion experiments to determine the contribution of ST3GAL1 to total sialyltransferase activity in tissue lysates.

What are the emerging therapeutic applications for recombinant pig ST3GAL1 in research?

Recombinant pig ST3GAL1 has significant potential in various therapeutic research applications, particularly in areas where controlled sialylation is desired. The enzyme's ability to add terminal sialic acid residues to glycoproteins and glycolipids makes it valuable for glycoengineering applications aimed at modifying immunological properties of biologics.

In xenotransplantation research, manipulating sialylation patterns on pig tissues is crucial for reducing hyperacute rejection responses. By modifying α-Gal epitopes through sialylation, researchers can potentially reduce the immunogenicity of porcine tissues. This application becomes particularly relevant when considered alongside other genetic modifications, such as the CMAH knockouts that have been successful in pigs .

For immunomodulatory research, recombinant ST3GAL1 can be employed to study how specific sialylation patterns influence immune cell function and survival. Given the enzyme's role in T cell homeostasis and its upregulation during infection , synthesizing defined sialylated structures allows researchers to probe the molecular mechanisms by which sialic acids regulate immune responses.

In biopharmaceutical applications, controlling glycoprotein sialylation can enhance therapeutic protein half-life and reduce immunogenicity. Recombinant ST3GAL1 enables in vitro sialylation of therapeutic glycoproteins produced in expression systems with limited sialylation capacity. This enzymatic remodeling approach offers advantages over chemical sialylation methods by providing linkage-specific modification.

How might ST3GAL1 serve as a potential target in infectious disease research?

The significant upregulation of ST3GAL1 observed during Trypanosoma brucei brucei infection in pigs (5-42 fold increases) suggests this enzyme plays a critical role in host-pathogen interactions . This dramatic response indicates ST3GAL1 may serve as a potential therapeutic target in infectious disease research through several mechanisms.

In trypanosomal infections, parasites express sialidases that remove sialic acids from host cells, contributing to pathogenesis. The upregulation of ST3GAL1 may represent a compensatory host response to restore sialylation. Understanding this balance between parasite-mediated desialylation and host-mediated resialylation opens avenues for therapeutic intervention that could tilt this balance in favor of the host.

For viral infections, many viruses utilize sialic acid-containing receptors for cellular attachment and entry. Modulating ST3GAL1 activity could potentially alter the availability of these receptors, influencing viral tropism and infectivity. This approach might be particularly relevant for respiratory viruses that bind to α2,3-linked sialic acids.

Bacterial pathogens that express sialic acid-binding adhesins may also be affected by alterations in ST3GAL1 activity. Targeting ST3GAL1 could modify the sialylation pattern of mucosal surfaces, potentially reducing bacterial adherence and colonization. Furthermore, some pathogens mimic host sialylation to evade immune recognition, making the sialylation machinery a potential target for anti-virulence strategies.

Research approaches to explore ST3GAL1 as a target should include:

  • Developing specific inhibitors of ST3GAL1 for in vitro and in vivo testing

  • Creating conditional knockout models to assess the impact of ST3GAL1 deficiency on infection outcomes

  • Investigating temporal regulation of ST3GAL1 during different infection phases

  • Determining how ST3GAL1 activity influences pathogen binding, invasion, and immune evasion

What are the current technical challenges in working with recombinant pig ST3GAL1?

Researchers working with recombinant pig ST3GAL1 face several technical challenges that impact enzyme production, stability, and activity assessment. Understanding these limitations is crucial for experimental design and data interpretation.

Expression and purification obstacles represent primary challenges. As a type II transmembrane protein, full-length ST3GAL1 contains a hydrophobic transmembrane domain that complicates expression and may lead to aggregation or improper folding. While truncated versions lacking this domain can be produced as soluble proteins, they may display altered kinetic properties. Additionally, ensuring proper glycosylation of the enzyme itself is critical, as N-glycosylation affects ST3GAL1 stability and activity.

Substrate availability presents another significant hurdle. The nucleotide sugar donor CMP-Neu5Ac is expensive and can be unstable during prolonged reactions. Synthesizing or isolating appropriate acceptor substrates with terminal Gal-β-1,3-GalNAc structures in sufficient quantities for kinetic studies can be technically challenging and resource-intensive.

Activity assay limitations also exist. Distinguishing ST3GAL1 activity from other sialyltransferases in mixed samples requires specific acceptor substrates and careful experimental design. The products of sialyltransferase reactions often require sophisticated analytical methods for characterization, including mass spectrometry or NMR analysis, which may not be universally available.

Finally, translating in vitro findings to in vivo contexts presents significant complexity. The biological function of ST3GAL1 depends on its tissue-specific expression, subcellular localization, and access to appropriate acceptor substrates in the Golgi apparatus. Recreating these conditions experimentally or interpreting the relevance of in vitro studies to physiological settings requires careful consideration of the cellular glycosylation machinery as a whole.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.