Recombinant Pig Cysteinyl leukotriene receptor 1 (CYSLTR1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pig Cysteinyl Leukotriene Receptor 1 (CYSLTR1) is a genetically engineered protein produced in Escherichia coli to study the structure and function of the native cysteinyl leukotriene receptor in pigs (Sus scrofa). CYSLTR1 belongs to the G protein-coupled receptor (GPCR) family and mediates responses to cysteinyl leukotrienes (CysLTs), lipid mediators involved in inflammatory and immune processes .

Key AttributesDetails
Host SystemE. coli
TagN-terminal His tag
Protein LengthFull-length (1–340 amino acids)
UniProt IDQ95N02
Molecular Weight~38 kDa (calculated)
Purity>90% (SDS-PAGE verified)

Functional Roles and Signaling Mechanisms

CYSLTR1 activation by leukotrienes (LTD₄ > LTC₄ >> LTE₄) triggers multiple pathways:

  • Gq/11-dependent signaling: Increases intracellular calcium and inositol phosphate (IP₁), driving smooth muscle contraction and inflammation .

  • Pathological associations: Linked to fibrosis, cancer progression (e.g., colorectal, breast), and neurological disorders in preclinical models .

Ligand PotencyOrder
LTD₄High affinity
LTC₄Moderate
LTE₄Low

Research Applications

Recombinant pig CYSLTR1 is pivotal for:

  1. Drug Discovery: Screening antagonists (e.g., Montelukast) to target inflammatory diseases .

  2. Binding Assays: Characterizing ligand-receptor interactions using radiolabeled or fluorescent ligands .

  3. Structural Studies: Resolving antagonist-bound conformations to guide drug design .

Example Application Table

Study TypeMethodologyOutcome
Calcium flux assayBMM cells + LTD₄ stimulationConfirmed receptor functionality
Cancer researchCRC cell proliferation assaysCysLTR1 inhibition reduced tumor growth

Production and Quality Control

The recombinant protein is produced under stringent conditions:

  • Expression: Codon-optimized CYSLTR1 gene cloned into E. coli .

  • Purification: Immobilized metal affinity chromatography (IMAC) for His-tagged protein.

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); reconstituted with glycerol for stability .

ParameterSpecification
Reconstitution0.1–1.0 mg/mL in sterile water
Long-term storage-80°C with 50% glycerol
StabilityAvoid repeated freeze-thaw cycles

Comparative Analysis Across Species

Pig CYSLTR1 exhibits sequence divergence from human (71% identity) and guinea pig (82% identity), influencing ligand specificity and signaling .

SpeciesUniProt IDKey Difference
Pig (Sus scrofa)Q95N02Unique extracellular loop residues
HumanQ9Y271Altered TM3 microswitches (FR motif)
Guinea PigQ2NNR5Modified ligand-binding pocket

Limitations and Future Directions

While recombinant pig CYSLTR1 enables cross-species studies, gaps remain:

  • In vivo models: Limited data on pig-specific pathologies (e.g., respiratory or cancer models).

  • Structural insights: High-resolution cryo-EM or X-ray structures are needed to clarify activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYSLTR1; CYSLT1; Cysteinyl leukotriene receptor 1; CysLTR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MDGVRNLTVSCASSNTCNDTIDDFRNQVYSTLYSMITVVGFFGNGFVLYVLIKTYHEKSA YQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM SFFRCIAIVFPVQNINLITHKKAKIVCIAIWIFVILTSSPFLMSTSYKDEKNNTKCFEPP QXNQAKYHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKNSMKKNISSRKKAIGMIIV VTAAFLISFMPYHIQRTIHLHFLHNDTKHCDSVLRMQKSVXITLSLAASNCCFDPLLYFF SGGNFREGLSTFRKHSLSTMTYVPKKKTSLPEKAQEIYKE
Uniprot No.

Target Background

Function
Cysteinyl leukotriene receptor 1 (CYSLTR1) is a receptor mediating microvascular smooth muscle constriction during inflammatory responses. This is achieved through G-protein activation of a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cysteinyl Leukotriene Receptor 1 (CYSLTR1)?

Cysteinyl Leukotriene Receptor 1 (CYSLTR1) is a G protein-coupled receptor that recognizes inflammatory lipid mediators known as cysteinyl leukotrienes. This receptor plays significant roles in several physiological and pathological processes, including smooth muscle constriction, vascular permeability, and macrophage chemokine release . CYSLTR1 is encoded by the Cysltr1 gene and is prominently expressed in cells of the macrophage lineage, including osteoclasts . The receptor functions as a critical mediator in inflammatory signaling pathways and has been implicated in various immune-related disorders. In porcine systems, CYSLTR1 maintains these fundamental characteristics while exhibiting species-specific structural features that can be valuable for comparative receptor biology studies.

How is recombinant pig CYSLTR1 produced for research applications?

Recombinant pig CYSLTR1 is produced through heterologous expression in E. coli bacterial systems. The process typically involves:

  • Cloning the full-length pig CYSLTR1 gene (encoding amino acids 1-340) into an expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Transforming the expression construct into E. coli

  • Inducing protein expression under optimized conditions

  • Cell lysis and extraction of the recombinant protein

  • Purification via His-tag affinity chromatography

  • Quality control assessment by SDS-PAGE (ensuring >90% purity)

  • Lyophilization to produce a stable powder form

This production method yields research-grade protein suitable for various applications including structural studies, antibody production, and in vitro binding assays.

What are the optimal storage and handling conditions for recombinant pig CYSLTR1?

For maximum stability and activity retention of recombinant pig CYSLTR1, researchers should follow these specific storage and handling protocols:

ConditionRecommendationNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation prior to opening is recommended
Buffer compositionTris/PBS-based, 6% Trehalose, pH 8.0Maintains protein stability
Glycerol addition5-50% final concentration (50% recommended)For long-term storage after reconstitution
Working aliquots4°CStable for up to one week
Freeze-thawAvoid repeated cyclesSignificantly reduces protein activity

These conditions ensure optimal protein stability and maintain the structural integrity necessary for experimental applications. The inclusion of trehalose in the storage buffer acts as a protein stabilizer during the lyophilization process and subsequent storage.

How does CYSLTR1 contribute to inflammatory and autoimmune pathways?

CYSLTR1 plays a significant role in inflammatory and autoimmune conditions through several mechanistic pathways:

  • In systemic lupus erythematosus (SLE), CYSLTR1 expression is elevated and correlates directly with disease activity, with evidence suggesting this upregulation may be driven by DNA demethylation mechanisms .

  • The receptor mediates inflammatory signaling through interaction with cysteinyl leukotrienes, particularly leukotriene D4, which triggers intracellular calcium flux—a critical event in inflammation cascade activation .

  • CYSLTR1 significantly impacts B cell differentiation through modulation of the BCL6-BLIMP1-XBP1 transcriptional axis, which regulates antibody-secreting cell development .

  • The PI3K/AKT/mTOR pathway appears to be a downstream target of CYSLTR1 activation, with implications for cellular proliferation and survival in immune contexts .

  • In experimental models, CYSLTR1 knockout or inhibition (via antagonists like montelukast) demonstrates amelioration of autoimmune manifestations, including reduced plasma cell frequencies and decreased antibody production .

These findings position CYSLTR1 as a potential therapeutic target in autoimmune conditions, particularly those involving dysregulated B cell responses and excessive antibody production.

What methodologies are effective for studying CYSLTR1 signaling mechanisms?

Researchers investigating CYSLTR1 signaling can employ several validated methodological approaches:

  • Calcium Flux Assays: Measuring intracellular calcium mobilization in response to leukotriene D4 stimulation provides direct evidence of receptor activation. This can be performed using fluorescent calcium indicators in cells expressing CYSLTR1 .

  • CRISPR-Cas9 Gene Disruption: Generation of loss-of-function mutants through targeted gene editing. This approach has been successfully used to create both frameshift mutations resulting in premature stop codons and in-frame mutations affecting receptor structure .

  • Receptor Antagonism Studies: Application of CYSLTR1 antagonists such as montelukast or REV5901 to block receptor function, with subsequent measurement of downstream signaling events or physiological responses .

  • Transcriptomic Analysis: RNA sequencing following CYSLTR1 modulation to identify regulated gene networks, as demonstrated in studies examining the BCL6-BLIMP1-XBP1 axis in B cells .

  • Pathway Inhibitor Studies: Use of specific inhibitors (e.g., for PI3K or mTOR) to dissect the contribution of individual signaling components downstream of CYSLTR1 activation .

  • Immunological Challenge Models: In vivo systems such as Keyhole Limpet Hemocyanin (KLH) immunization to assess CYSLTR1's role in normal and pathological immune responses .

These complementary approaches enable comprehensive characterization of CYSLTR1 signaling pathways and their functional significance in various biological contexts.

How can recombinant pig CYSLTR1 be used in cross-species comparative receptor studies?

Recombinant pig CYSLTR1 offers valuable opportunities for cross-species comparative studies due to several factors:

  • Evolutionary Conservation Analysis: The pig (Sus scrofa) CYSLTR1 represents an important evolutionary point of comparison between rodent models and human systems. Sequence alignment and structural prediction algorithms can identify conserved motifs critical for receptor function.

  • Binding Affinity Comparisons: Direct comparison of ligand binding properties between pig, human, and rat CYSLTR1 can reveal species-specific pharmacological profiles. This is particularly relevant for drug development programs targeting this receptor family .

  • Epitope Mapping: Using recombinant proteins from different species allows identification of conserved and variable epitopes, informing the development of cross-reactive or species-specific antibodies for research and diagnostic applications.

  • Functional Domain Analysis: Comparative mutagenesis studies focusing on divergent regions can identify species-specific differences in receptor activation, desensitization, or coupling to downstream signaling pathways.

  • Pharmacological Diversity: Testing receptor antagonists like montelukast across species variants can reveal important differences in drug responsiveness and specificity, contributing to translational understanding of these therapeutic agents .

These comparative approaches enhance our understanding of CYSLTR1 biology beyond single-species models and provide insights into evolutionary adaptations of inflammatory signaling pathways.

What is the relationship between CYSLTR1 and bone metabolism?

The relationship between CYSLTR1 and bone metabolism presents a complex and somewhat contradictory picture:

These findings collectively suggest that while CYSLTR1 may participate in bone metabolism under specific conditions, it is not essential for osteoclast differentiation or pathological bone loss, highlighting the complexity of inflammatory signaling in skeletal biology.

What validation methods ensure the functionality of recombinant pig CYSLTR1?

To ensure the functionality and integrity of recombinant pig CYSLTR1 preparations, researchers should implement the following validation methods:

  • SDS-PAGE Analysis: Confirming protein purity (>90%) and expected molecular weight through electrophoretic separation .

  • Western Blotting: Using anti-His antibodies to verify the presence of the His-tag and anti-CYSLTR1 antibodies to confirm protein identity.

  • Mass Spectrometry: Peptide mapping to verify the amino acid sequence and identify any post-translational modifications or unexpected truncations.

  • Ligand Binding Assays: Using radiolabeled or fluorescently labeled cysteinyl leukotrienes to confirm retention of binding capacity.

  • Calcium Mobilization Assays: Testing the ability of the recombinant receptor to induce calcium flux when reconstituted into appropriate cell systems .

  • Receptor Antagonist Studies: Verifying that known CYSLTR1 antagonists (e.g., montelukast) can block receptor activity in functional assays .

  • Structural Integrity Assessment: Using circular dichroism or other spectroscopic methods to confirm proper protein folding.

These complementary approaches provide comprehensive validation of recombinant CYSLTR1 functionality, ensuring reliable results in subsequent experimental applications.

How should researchers design experiments to study CYSLTR1 inhibition in autoimmune disease models?

When designing experiments to investigate CYSLTR1 inhibition in autoimmune disease models, researchers should consider these methodological approaches:

  • Model Selection: Choose appropriate autoimmune models relevant to CYSLTR1 biology, such as pristane-induced lupus, which has demonstrated CYSLTR1 involvement. This model effectively recapitulates lupus-like symptoms and allows evaluation of B cell-mediated pathology .

  • Intervention Strategies:

    • Pharmacological inhibition using CYSLTR1 antagonists (e.g., montelukast)

    • Genetic approaches using CYSLTR1-knockout animals

    • Combination approaches to address potential compensation mechanisms

  • Assessment Parameters:

    • Disease activity indices specific to the model

    • Quantification of plasma cell frequencies and antibody-secreting cells

    • Measurement of autoantibody levels

    • Evaluation of tissue pathology

    • Analysis of BCL6, BLIMP1, and XBP1 expression in B cells

  • Control Experiments:

    • Include appropriate genetic background controls

    • Use both preventive and therapeutic intervention paradigms

    • Implement dose-response studies for pharmacological agents

    • Consider off-target effects through combination with genetic models

  • Translational Relevance:

    • Correlate findings with human disease parameters

    • Evaluate expression of CYSLTR1 in patient samples

    • Assess DNA methylation status of the CYSLTR1 gene

This comprehensive experimental design allows for robust evaluation of CYSLTR1 as both a disease biomarker and therapeutic target in autoimmune conditions.

What are the critical factors in expressing and purifying functional recombinant pig CYSLTR1?

Successful expression and purification of functional recombinant pig CYSLTR1 requires attention to several critical factors:

FactorConsiderationImpact on Quality
Expression SystemE. coli is commonly used, but membrane proteins may benefit from eukaryotic systemsAffects protein folding and post-translational modifications
Fusion TagsN-terminal His-tag facilitates purification but may affect functionBalance between purification efficiency and functional impact
Induction ConditionsTemperature, inducer concentration, and duration affect expression levelsOptimization prevents inclusion body formation
Lysis MethodsMembrane proteins require effective solubilizationDetermines initial protein quality and yield
Purification StrategyMulti-step approach including affinity chromatographyEnsures high purity (>90%) as determined by SDS-PAGE
Buffer CompositionTris/PBS-based buffer with 6% Trehalose at pH 8.0Maintains protein stability during and after purification
Quality ControlSDS-PAGE, Western blotting, and functional assaysConfirms identity, purity, and activity
LyophilizationControlled freeze-drying processProduces stable powder form for long-term storage

Researchers should also consider that the transmembrane nature of CYSLTR1 presents specific challenges for obtaining properly folded, functional protein. Alternative approaches such as nanodiscs or detergent micelles may be necessary to maintain the native conformation of the receptor during purification and subsequent applications.

How can researchers effectively compare CYSLTR1 function across different species?

To effectively compare CYSLTR1 function across different species, researchers should implement a systematic approach:

  • Sequence and Structural Analysis:

    • Perform multiple sequence alignments of CYSLTR1 from pig, human, rat, and other relevant species

    • Identify conserved domains, particularly within ligand-binding regions

    • Use homology modeling to predict structural differences

    • Quantify evolutionary conservation scores for functional domains

  • Expression Profiling:

    • Compare tissue and cellular expression patterns across species using standardized quantitative methods

    • Evaluate regulatory mechanisms controlling expression (e.g., DNA methylation status)

    • Assess developmental expression trajectories in comparable tissues

  • Functional Comparisons:

    • Utilize consistent methodologies for measuring receptor activation (e.g., calcium flux assays)

    • Compare pharmacological profiles using standardized ligand panels

    • Evaluate species-specific differences in signaling pathway coupling

    • Measure receptor internalization and desensitization kinetics

  • Comparative Antagonist Studies:

    • Test efficacy of CYSLTR1 antagonists across species variants

    • Determine IC50 values under identical experimental conditions

    • Identify species-specific pharmacological differences with clinical relevance

  • Physiological Response Assessment:

    • Compare in vivo responses to CYSLTR1 modulation in different species

    • Evaluate disease model responses to genetic deletion or pharmacological inhibition

    • Assess the impact on comparable biological processes (e.g., B cell differentiation, inflammatory responses)

This comprehensive approach enables identification of both conserved functional aspects and species-specific adaptations, enhancing translational relevance of findings and improving predictive value of pre-clinical models.

What are common challenges in working with recombinant CYSLTR1 and how can they be addressed?

Researchers working with recombinant CYSLTR1 frequently encounter several technical challenges that can be addressed through specific methodological approaches:

  • Protein Solubility Issues:

    • Challenge: As a transmembrane protein, CYSLTR1 has hydrophobic domains that can cause aggregation.

    • Solution: Optimize buffer conditions with appropriate detergents or lipid environments; consider fusion tags that enhance solubility; use trehalose (6%) as a stabilizing agent .

  • Functional Conformation:

    • Challenge: Maintaining the native three-dimensional structure necessary for ligand binding.

    • Solution: Employ gentle purification methods; validate functionality through ligand binding assays; consider reconstitution into membrane mimetics or nanodiscs.

  • Protein Degradation:

    • Challenge: Proteolytic degradation during expression and purification.

    • Solution: Include protease inhibitors throughout the purification process; optimize storage conditions; prepare single-use aliquots to avoid freeze-thaw cycles .

  • Expression Yield:

    • Challenge: Low expression levels in heterologous systems.

    • Solution: Optimize codon usage for the expression host; evaluate different promoter systems; consider specialized expression strains.

  • Post-translational Modifications:

    • Challenge: E. coli lacks the machinery for mammalian post-translational modifications.

    • Solution: For applications requiring glycosylation or other modifications, consider eukaryotic expression systems as alternatives.

  • Validation of Functionality:

    • Challenge: Confirming that the recombinant protein retains native activity.

    • Solution: Implement calcium flux assays in reconstituted systems; compare ligand binding profiles with native receptor; evaluate antagonist responsiveness .

Addressing these challenges requires a strategic approach combining optimized biochemical methods with rigorous functional validation to ensure that experimental findings accurately reflect the biological properties of CYSLTR1.

How should researchers interpret conflicting data between pharmacological and genetic CYSLTR1 studies?

When faced with discrepancies between pharmacological inhibition and genetic deletion studies of CYSLTR1, researchers should consider these interpretative frameworks:

This systematic approach helps reconcile apparent contradictions and builds a more nuanced understanding of CYSLTR1 biology across experimental paradigms.

What are emerging research areas for CYSLTR1 in immunological disorders?

Several promising research directions are emerging for CYSLTR1 in immunological disorders:

  • Targeted Therapy Development:

    • Development of next-generation CYSLTR1 antagonists with enhanced specificity and reduced off-target effects

    • Investigation of dual-action compounds targeting CYSLTR1 and complementary inflammatory pathways

    • Exploration of tissue-specific CYSLTR1 modulation to minimize systemic effects

  • Biomarker Applications:

    • Validation of CYSLTR1 expression as a biomarker for disease activity in SLE and other autoimmune conditions

    • Investigation of epigenetic regulation of CYSLTR1, particularly DNA methylation patterns as diagnostic or prognostic indicators

    • Development of non-invasive methods to monitor CYSLTR1 activity in vivo

  • B Cell-Targeted Approaches:

    • Further elucidation of the BCL6-BLIMP1-XBP1 regulatory axis in B cells as influenced by CYSLTR1 signaling

    • Development of therapeutic strategies targeting this axis for autoantibody-mediated diseases

    • Investigation of CYSLTR1's role in memory B cell formation and long-term humoral immunity

  • Signaling Pathway Integration:

    • Detailed mapping of crosstalks between CYSLTR1 and the PI3K/AKT/mTOR pathway

    • Exploration of combinatorial therapeutic approaches targeting multiple nodes in these interconnected pathways

    • Systems biology approaches to model CYSLTR1 signaling networks in health and disease

  • Tissue-Specific Functions:

    • Investigation of CYSLTR1's role in tissue-resident immune cells beyond circulating populations

    • Exploration of potential functions in non-immune tissues where the receptor is expressed

    • Assessment of CYSLTR1 contribution to tissue-specific manifestations of systemic autoimmune diseases

These emerging areas offer significant potential for advancing both basic understanding of CYSLTR1 biology and therapeutic applications in immunological disorders.

How might species differences in CYSLTR1 impact translational research?

Species differences in CYSLTR1 have significant implications for translational research that researchers must consider:

  • Pharmacological Responsiveness:

    • Species-specific variations in binding pockets may affect antagonist efficacy

    • Differential responses to the same compounds across species could complicate drug development

    • Translational failures may occur if human CYSLTR1 differs significantly from preclinical models

  • Signaling Pathway Coupling:

    • Species differences in G-protein coupling efficiency or preference

    • Variations in downstream signaling cascade components

    • Potential differences in receptor desensitization and internalization kinetics

  • Expression Patterns:

    • Tissue distribution of CYSLTR1 may vary between species

    • Cell type-specific expression differences could affect disease relevance

    • Developmental timing of expression may differ across species

  • Genetic Regulation:

    • Species-specific differences in promoter regions affecting expression regulation

    • Variations in epigenetic control mechanisms, such as DNA methylation patterns

    • Different splicing variants with potentially distinct functions

  • Physiological Roles:

    • Function in specific biological processes may vary between species

    • The relative importance of CYSLTR1 in inflammation may be species-dependent

    • Species differences in compensatory mechanisms when CYSLTR1 is inhibited or deleted

To address these challenges, researchers should:

  • Perform careful cross-species comparisons before extrapolating findings

  • Consider humanized animal models for critical preclinical studies

  • Validate findings across multiple species when possible

  • Use recombinant proteins from different species (pig, human, rat) for comparative studies

  • Employ bioinformatic approaches to predict functional consequences of sequence variations

These considerations are essential for effective translation of CYSLTR1 research findings from animal models to human applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.