Recombinant Pig Cytochrome b-245 heavy chain (CYBB)

Shipped with Ice Packs
In Stock

Description

Table 1: Biochemical Properties

PropertySpecification
Amino Acid LengthFull-length: 484 residues; Partial: varies
Expression SystemsE. coli, Yeast, Baculovirus, Mammalian cells
TagsHis-tag (common)
Purity≥85% (SDS-PAGE verified)

Production and Purification

Recombinant Pig CYBB is produced using heterologous expression systems, with protocols optimized for solubility and functionality:

  • Expression: Codon-optimized vectors for high yield in E. coli or eukaryotic systems .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged proteins) .

  • Storage: Lyophilized or liquid forms at -20°C/-80°C; reconstitution in sterile water with glycerol (5–50%) for stability .

Research Applications

  • NADPH Oxidase Studies: Used to reconstitute oxidase activity in vitro, enabling mechanistic studies of ROS production .

  • Immune Response Modeling: Facilitates cross-species comparisons of phagocyte function .

  • Disease Research: Serves as a control in chronic granulomatous disease (CGD) studies, where CYBB mutations impair microbial killing .

Functional Insights from Studies

  • Superoxide Generation: The protein’s ability to bind FAD and heme is critical for electron transfer from NADPH to oxygen .

  • Species-Specific Variations: Pig CYBB shares ~80% sequence homology with human CYBB, making it a viable model for translational studies .

  • Regulatory Interactions: Requires co-expression with CYBA (α-subunit) for stable NADPH oxidase complex formation .

Stability and Handling

  • Shelf Life: 12 months (lyophilized) or 6 months (liquid) at -80°C .

  • Reconstitution: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Clinical and Therapeutic Relevance

While direct clinical applications remain experimental, Recombinant Pig CYBB aids in:

  • Gene Therapy Development: Benchmarking CYBB restoration in CGD models .

  • Drug Screening: Testing NADPH oxidase inhibitors for inflammatory diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag requirements, please inform us. We will prioritize developing the specified tag type.
Synonyms
CYBB; Cytochrome b-245 heavy chain; CGD91-phox; Cytochrome b(558 subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
STRVRRQLDRNLTFHKMVAWMIALHATIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGD KPNETYLNFVRQRIKNPEGGLYVAVTRLAGITGVVITLCLILIITSSTKTIRRSYFEVFW YTHHLFVIFFIGLAIHGAERIVRRQTPKSLLVHDPKACAQNISQWGKIKDCPIPEFAGNP PMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFRMEVGQYIF VKRPAVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIA VDGPFGTASEDVFSYQVVMLVGAGIGVTPFASILKSVWYKYCNNATNLRLKKIYFYWLCR DTHAFEWFADLLQLLETQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLK QKTLYGRPNWDNEFKTIASQHPTTRIGVFLCGPEALAETLNKQCISNSDSSPRGVHFIFN KENF
Uniprot No.

Target Background

Function
Cytochrome b-245 heavy chain (CYBB) is a critical component of the membrane-bound oxidase of phagocytes, responsible for generating superoxide. It acts as the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. CYBB also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes.
Gene References Into Functions
  1. These results suggested that resveratrol strongly enhances the RA-induced O2(-)-generating activity via up-regulation of gp91-phox gene expression in U937 cells. PMID: 29183727
  2. A sub-vasomotor concentration of ET-1 leads to vascular dysfunction by impairing endothelium-dependent NO-mediated dilation via p38 kinase-mediated production of superoxide from NADPH oxidase following ETA receptor activation PMID: 26211713
  3. CYBB is activated during ischemia/reperfusion in a complement-dependent manner, and may contribute to renal damage. PMID: 25017967
  4. Reactive oxygen species generated by NADPH oxidase contribute to the aberrant pulmonary arterial responses in piglets exposed to 3 days of hypoxia. PMID: 18757525
  5. Upregulation of PPAR-gamma and NADPH oxidases are involved in restenosis. PMID: 19562688

Show More

Hide All

Database Links

KEGG: ssc:397108

STRING: 9823.ENSSSCP00000029153

UniGene: Ssc.151

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is porcine Cytochrome b-245 heavy chain (CYBB) and what is its significance in immunological research?

Porcine Cytochrome b-245 heavy chain (CYBB), also known as gp91phox, is a critical component of the NADPH oxidase complex essential for reactive oxygen species (ROS) production in phagocytic cells. The protein consists of 484 amino acids and functions as the catalytic subunit that transfers electrons from NADPH to molecular oxygen, generating superoxide anions crucial for microbial killing .

The significance of porcine CYBB in immunological research stems from its essential role in innate immunity and its high degree of conservation across mammalian species. Mutations in CYBB cause X-linked chronic granulomatous disease (CGD), characterized by defective ROS production and increased susceptibility to bacterial and fungal infections . Porcine models are particularly valuable due to their physiological similarities to humans, making them excellent translational models for studying human CGD and related immunodeficiencies.

What are the optimal conditions for expression and purification of recombinant pig CYBB?

Based on current research protocols, the optimal conditions for expression and purification of recombinant pig CYBB involve:

Expression System:

  • E. coli is the preferred expression system for full-length recombinant pig CYBB protein (1-484aa)

  • N-terminal His-tag fusion enhances purification efficiency while minimizing interference with protein function

Expression Conditions:

  • Induction: Typically IPTG at 0.5-1.0 mM concentration

  • Temperature: 16-18°C after induction (reduces inclusion body formation)

  • Duration: 16-20 hours for optimal yield without degradation

Purification Protocol:

  • Cell lysis in Tris/PBS-based buffer with protease inhibitors

  • Purification using nickel affinity chromatography

  • Buffer exchange to Tris/PBS-based buffer, pH 8.0

  • Addition of 6% trehalose as a stabilizing agent

Storage Recommendations:

  • Lyophilization for long-term stability

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (optimally 50%) for aliquoting and storage at -20°C/-80°C

  • Avoiding repeated freeze-thaw cycles to maintain protein integrity

Researchers should verify protein purity using SDS-PAGE (>90% purity is considered suitable for most research applications) .

How can researchers assess the functionality of recombinant pig CYBB in experimental systems?

Assessing the functionality of recombinant pig CYBB requires multiple complementary approaches:

1. Hydrogen Peroxide Production Assay:

  • Stimulate cells with Phorbol myristate acetate (PMA)

  • Measure H₂O₂ production using fluorescent or colorimetric probes

  • Compare results with positive (wild-type cells) and negative (CYBB-deficient cells) controls

2. Protein Expression Analysis:

  • Western blotting with specific anti-CYBB antibodies

  • Flow cytometry for surface expression in intact cells

  • Immunofluorescence microscopy for localization studies

3. Electron Transport Activity:

  • Cytochrome c reduction assay to measure superoxide production

  • Dihydrorhodamine 123 (DHR) oxidation for assessment of oxidative burst capacity

  • Chemiluminescence assays for kinetic analysis of ROS production

4. Functional Complementation:

  • Transfect recombinant CYBB into CYBB-deficient cells (from CGD patients or knockout models)

  • Assess restoration of NADPH oxidase activity

  • Evaluate bacterial/fungal killing capacity in reconstituted systems

Research indicates that functional assessment should include both biochemical assays (enzyme activity) and biological readouts (microbial killing capacity) to comprehensively evaluate recombinant CYBB functionality in experimental systems.

How are CYBB mutations characterized in chronic granulomatous disease (CGD) models, and what methods are most effective?

Characterization of CYBB mutations in CGD models involves a multifaceted approach combining functional, genetic, and computational analyses:

Functional Characterization:

  • Assessment of H₂O₂ production upon PMA stimulation reveals impaired ROS generation in neutrophils carrying CYBB mutations

  • Flow cytometry analysis of gp91phox expression identifies abnormal protein expression patterns

  • Bacterial/fungal killing assays demonstrate functional consequences of CYBB mutations

Genetic Analysis Methods:

  • DNA sequencing of the CYBB gene to identify specific mutations:

    • Missense mutations (e.g., c.925G>A/p.E309K in exon 9, c.732T>G/p.C244W in exon 7)

    • Nonsense mutations (e.g., c.216T>A/p.C72X in exon 3)

  • PCR-based approaches to detect larger deletions/insertions

Mutation Pathogenicity Assessment:
Computational tools provide complementary evidence for mutation pathogenicity:

Mutation Prediction ToolPurposeExample Application
PolyPhen-2Predicts impact of amino acid substitutionsValidated pathogenicity of c.925G>A mutation
SIFTPredicts effects of coding variants on protein functionConfirmed deleterious nature of C244W substitution
MutationTasterEvaluates disease-causing potential of DNA sequence alterationsProvided supporting evidence for pathogenicity

The most effective approach combines these methods to establish clear genotype-phenotype correlations. Researchers have successfully used these integrated approaches to characterize both previously reported mutations (c.925G>A/p.E309K) and novel mutations (c.216T>A/p.C72X and c.732T>G/p.C244W) in the CYBB gene .

What role does CYBB play in viral infection models, and how can recombinant pig CYBB advance this research?

CYBB plays a significant role in antiviral immunity through several mechanisms that can be studied using recombinant pig CYBB:

CYBB in Viral Infection Models:

  • In porcine bone marrow-derived antigen-presenting cells (BM-APCs), CYBB expression is altered during Classical Swine Fever Virus (CSFV) infection

  • CYBB-generated ROS contribute to innate immune signaling pathways that regulate antiviral responses

  • Different CSFV strains with varying pathogenicity showed distinct effects on CYBB-related pathways despite similar viral replication levels in BM-APCs

Transcriptomic Insights:
Analysis of gene expression in CSFV-infected cells revealed:

  • Differential regulation of CYBB-related pathways between high-virulence and moderate-virulence CSFV strains

  • Upregulation of immune checkpoint molecules (e.g., LAG3) in highly pathogenic infections

  • Altered expression of chemokines and cytokines (PPBP, CXCL8, IL-6) that interact with CYBB-dependent pathways

Research Applications of Recombinant Pig CYBB:

  • Structure-function studies to identify viral interaction domains

  • In vitro systems to assess how viral proteins modulate CYBB activity

  • Development of targeted antiviral strategies that preserve CYBB function

  • Comparative studies between pig and human CYBB to identify species-specific antiviral mechanisms

Recombinant pig CYBB can specifically advance this research by providing a controlled system to study:

  • Protein-protein interactions between viral components and CYBB

  • Effects of specific CYBB domains/mutations on viral replication

  • Comparative analyses between wild-type and mutant CYBB responses to viral challenge

What CRISPR/Cas9 strategies are most effective for CYBB knockout, and how do they compare with traditional methods?

CRISPR/Cas9 has revolutionized the generation of CYBB knockout models, offering several advantages over traditional methods:

Effective CRISPR/Cas9 Strategies for CYBB Knockout:

  • Targeting Critical Exons:

    • Exon 1 targeting disrupts the N-terminal region essential for protein expression

    • Exon 3 targeting has proven highly effective, creating functional knockouts as demonstrated in NSG mice

    • Both approaches yielded high rates of indel formation at target sites

  • Delivery Methods:

    • Direct microinjection of Cas9 mRNA and CRISPR single-guide RNAs (sgRNAs) into zygotes

    • Production of founder animals with high editing efficiency (all mice exhibited deletions in at least one CYBB allele)

  • Verification Approaches:

    • Sequencing of target regions to confirm indel formation

    • Functional assays (ROS production) to validate phenotype

    • Expression analysis to confirm protein absence

Comparison with Traditional Methods:

ParameterCRISPR/Cas9Homologous Recombination
Time Required2-3 months9-12 months
EfficiencyHigh (>90% targeting)Low (~1-5% targeting)
Off-target EffectsPotential concern, can be minimizedMinimal concern
Background Strain FlexibilityCan be applied in any strain (e.g., NSG)Often C57BL/6 background
CostLowerHigher
MosaicismPossible in F0 generationTypically not an issue

The C57BL/6 X-CGD model generated through homologous recombination by Dinauer's group (targeting exon 3) was a pioneering approach , but CRISPR/Cas9 has significantly accelerated the development of new CYBB knockout models in diverse genetic backgrounds, including immunodeficient NSG mice .

A notable advantage of CRISPR/Cas9 is the ability to generate larger deletions (e.g., 235-bp deletion in CYBB) that ensure complete functional knockout , whereas traditional methods typically introduce smaller modifications that might retain partial function in some cases.

How do researchers evaluate the success of CYBB genetic modifications in porcine and murine models?

Evaluation of successful CYBB genetic modifications requires a comprehensive assessment approach:

Genetic Validation:

  • DNA sequencing to confirm targeted modifications

    • Identification of specific indels, substitutions, or larger deletions

    • Validation in multiple tissues to assess mosaicism

  • mRNA analysis to confirm transcriptional effects

    • RT-PCR to detect aberrant transcripts

    • Quantitative PCR to measure expression levels

Protein Expression Analysis:

  • Western blotting to assess CYBB protein expression

    • Complete absence in homozygous knockouts

    • Reduced expression in heterozygous females due to X-inactivation

  • Flow cytometry to quantify cell-specific expression

    • Particularly in neutrophils and macrophages

    • Can reveal mosaicism in heterozygous females

Functional Assessment:

  • ROS production assays

    • Stimulation with PMA to activate NADPH oxidase

    • Measurement of H₂O₂ or superoxide using fluorescent probes

  • Microbial killing assays

    • Challenges with Staphylococcus aureus or Aspergillus fumigatus

    • Quantification of killing efficiency compared to wild-type controls

Phenotypic Evaluation:

  • Spontaneous infection susceptibility

    • Monitoring for spontaneous bacterial or fungal infections

    • Comparative survival analysis

  • Experimental infection models

    • Controlled challenges with specific pathogens

    • Assessment of immune response and disease progression

The gold standard for validating X-CGD models includes demonstrating:

  • Complete absence of ROS production in stimulated neutrophils

  • Increased susceptibility to CGD-typical pathogens (S. aureus, A. fumigatus)

  • Phenotypic recapitulation of human X-CGD symptoms

How does pig CYBB compare to human CYBB, and what implications does this have for translational research?

Comparative analysis of pig and human CYBB reveals important similarities and differences with significant implications for translational research:

Structural Comparisons:

  • Pig CYBB (484 amino acids) shares approximately 90% sequence homology with human CYBB

  • Key functional domains are highly conserved, particularly those involved in electron transport

  • Transmembrane topology is preserved between species

  • Critical cysteine residues for proper folding and function are maintained across species

Functional Similarities:

  • Both pig and human CYBB function as the catalytic subunit of NADPH oxidase

  • Similar patterns of tissue expression with highest levels in phagocytic cells

  • Comparable reactivity to stimulants like PMA

  • Mutations in both species lead to CGD-like phenotypes with defective ROS production

Experimental Advantages of Pig Models:

  • Anatomical and physiological similarities to humans make pigs excellent models for human diseases

  • Immune system parallels, particularly in innate immunity mechanisms

  • The porcine BM-APC system closely mimics human myeloid cell development and function

  • Larger size allows for more extensive sampling and intervention testing

Implications for Translational Research:

Research ApplicationComparative AdvantageResearch Evidence
Gene Therapy TestingPig models better predict human immune responses to vectorsBMHC culture systems demonstrate similar transduction efficiency
Drug DevelopmentPharmacokinetics in pigs more closely resembles humansMore translatable drug dosing and metabolism
Cell-based TherapiesPorcine BM-APCs can model human APC therapiesGM-CSF stimulation creates comparable dendritic-like cells
Infection ModelsSimilar pathogen susceptibility patternsCSFV infection models reveal comparable host responses

The high conservation of CYBB between pigs and humans makes porcine models particularly valuable for testing therapeutic approaches for CGD. Studies using porcine bone marrow hematopoietic cells (BMHC) have demonstrated the utility of these models for understanding disease mechanisms and testing interventions .

What emerging technologies and research directions are advancing our understanding of CYBB function and therapeutic applications?

Several cutting-edge technologies and research approaches are advancing CYBB research:

1. Advanced Genetic Engineering Approaches:

  • CRISPR base editing for precise correction of point mutations in CYBB

  • Prime editing for introducing specific mutations without double-strand breaks

  • CRISPR/Cas9-mediated knock-in of reporter genes to track CYBB expression in vivo

  • Conditional CYBB knockout systems for tissue-specific and temporal control

2. Single-Cell Technologies:

  • Single-cell RNA sequencing to characterize cell-specific CYBB expression patterns

  • CITE-seq for simultaneous protein and RNA analysis of CYBB-expressing cells

  • Spatial transcriptomics to map CYBB expression in tissues during infection

3. Advanced Structural Biology:

  • Cryo-EM structures of the NADPH oxidase complex with CYBB

  • In silico molecular dynamics to predict effects of mutations

  • Structure-based drug design targeting CYBB modulation

4. Therapeutic Approaches:

  • Gene therapy using lentiviral vectors expressing functional CYBB

  • Small molecule activators of residual CYBB activity in partial-function mutants

  • CRISPR-mediated correction of CYBB mutations in hematopoietic stem cells

5. Disease Model Innovations:

  • Humanized pig models with human CYBB replacing porcine CYBB

  • Patient-derived organoids expressing mutant CYBB variants

  • Multi-omics approaches integrating transcriptomics, proteomics, and metabolomics

Recent transcriptomic analyses of porcine BM-APCs infected with CSFV strains of different virulence have revealed new insights into how CYBB-related pathways interact with viral pathogenesis . This research direction highlights the value of systems biology approaches in understanding CYBB function beyond its classic role in ROS production.

The combination of gene editing technologies with porcine models represents a particularly promising research direction, as it can potentially create more accurate human disease models while enabling precise correction strategies that could translate to human therapy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.