Recombinant Pig Cytochrome b561 (CYB561)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant pig CYB561 demonstrates redox properties typical of the CYB561 family :

Key Redox Parameters

  • Midpoint Potentials:

    • High-potential (HP) heme: ~+160 mV

    • Low-potential (LP) heme: ~+20 mV

  • Ascorbate Binding:

    • High-affinity site: ~0.016 mM

    • Low-affinity site: ~1.24 mM

Spectral Features

  • Optical Absorption:

    • Soret peak at 413 nm (oxidized)

    • Split α-bands at 560/530 nm (reduced) indicative of anisotropic heme environments

  • EPR Signatures:

    • Highly asymmetric low-spin (HALS) character for both hemes

    • No observable electronic interaction between hemes in oxidized or reduced states

Expression and Purification

The recombinant pig CYB561 is produced in E. coli with the following specifications :

ParameterDetail
Expression SystemEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionRequires deionized sterile water; glycerol (5–50%) enhances stability

Functional Roles

Recombinant CYB561 proteins, including the pig isoform, enable critical biological processes :

  • Trans-membrane Electron Transfer: Mediates ASC-dependent reduction of ferric iron (Fe³⁺) for cellular uptake

  • Ascorbate Recycling: Regenerates ASC from monodehydroascorbate in neuroendocrine tissues

  • Disease Relevance:

    • Potential involvement in tumor suppression pathways

    • Linked to iron metabolism disorders and neurodegenerative conditions

Comparative Analysis with Orthologs

The pig CYB561 shares functional similarities with other mammalian CYB561 proteins :

SpeciesHP Heme (mV)LP Heme (mV)Ascorbate Affinity (High/Low; mM)Localization
Pig (CYB561)+160+200.016 / 1.24Plasma membrane
Mouse (D1)+160+200.016 / 1.24Endosomal membranes
Bovine (A1)+171+810.0053 / 0.394Chromaffin granules

Research Applications

Recombinant pig CYB561 serves as a model for:

  • Mechanistic Studies: Elucidating trans-membrane electron transport kinetics

  • Drug Development: Screening for modulators of iron metabolism or redox signaling

  • Structural Biology: Homology modeling to predict 3D configurations of related CYB561 proteins

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
CYB561; Transmembrane ascorbate-dependent reductase CYB561; Cytochrome b-561; Cytochrome b561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
CYB561
Target Protein Sequence
MESPAGRTPAPGALPYYVAFSQLLGLTVVAVTGAWLGAYRGGIAWESALQFNVHPLCMII GLVFLQGDALLVYRVFRNEAKRTTKILHGLLHVLAFVIALVGLVAVFDYHRKKGIADLYS LHSWCGILVFVLFLAQWLVGLGFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVGTALLGL KEALLFQLGTKYSAFESEGVLANVLGLLLVAFGAVVLYILTRADWKRPLQAEEQALSMDF KTLTEGDSPSSQ
Uniprot No.

Target Background

Function
This transmembrane reductase utilizes ascorbate as an electron donor in the cytoplasm and transfers electrons across membranes to reduce monodehydro-L-ascorbate radical in the lumen of secretory vesicles. It is therefore involved in the regeneration and homeostasis of ascorbate within secretory vesicles, which in turn provides reducing equivalents necessary to support the activity of intravesicular enzymes.
Database Links
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Cytochrome b561 (CYB561) and how does it compare across species?

Cytochrome b561 (CYB561) proteins are integral membrane proteins characterized by six trans-membrane domains and two heme-b redox centers, one on each side of the host membrane. These proteins are found across a wide range of animal and plant phyla . The four central trans-membrane helices contain highly conserved histidine residues that coordinate the two heme-b chromophores . While specific pig CYB561 data is limited in our search results, comparative analysis with mouse models shows that CYB561 proteins maintain high structural conservation across mammalian species. The primary differences typically appear in non-functional regions rather than in the core functional domains.

The key distinguishing characteristics of CYB561 proteins include:

  • Ascorbate (ASC) reducibility

  • Trans-membrane electron transferring capability

  • Localization in non-bioenergetic membranes

  • Classification into seven groups based on primary structural similarities

What are the main functional properties of Cytochrome b561 and their physiological significance?

Cytochrome b561 functions primarily as a transmembrane electron transporter with well-established ascorbate reducibility. The protein facilitates electron transfer across cellular membranes, playing crucial roles in:

  • Cellular iron homeostasis through its ferrireductase function that helps maintain vesicular redox states

  • Neuropeptide activation and subsequent paracrine signaling processes

  • Support of the neuroendocrine phenotype in certain tissues

Physiologically, CYB561 contributes to intracellular Fe²⁺ concentration regulation, working alongside other iron regulatory genes (IRGs) like transferrin receptor (TFRC), ferritin (FTH), and ferroportin (FPN1) . This function is particularly important in specialized secretory cells where proper redox balance is essential for normal cellular processes.

What are the most effective expression systems for producing recombinant pig CYB561?

Based on successful approaches with mouse CYB561 homologs, the most effective expression systems for recombinant pig CYB561 include:

  • Yeast expression systems: Saccharomyces cerevisiae has been successfully used to express the recombinant form of mouse CYB561D1, allowing for subsequent purification from yeast membranes . This system offers proper protein folding and post-translational modifications important for membrane proteins.

  • Bacterial expression systems: Escherichia coli has been used for bovine CYB561A1 expression . While potentially higher-yielding, this system may require optimization for proper membrane protein folding.

For optimal expression, researchers should consider:

  • Using codon-optimized sequences for the expression host

  • Incorporating affinity tags (His-tag, FLAG-tag) for purification while ensuring minimal interference with protein function

  • Employing inducible promoter systems to control expression timing and level

What purification strategies yield the highest purity and activity for recombinant CYB561?

Purification of recombinant CYB561 requires specialized approaches due to its membrane-embedded nature. Based on studies with orthologous proteins, the following multi-step purification strategy is recommended:

  • Membrane isolation: Following cell lysis, differential centrifugation effectively separates membrane fractions containing the expressed CYB561.

  • Detergent solubilization: Careful selection of detergents is crucial; mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin help maintain protein structure and activity during extraction from membranes.

  • Affinity chromatography: If the recombinant protein contains an affinity tag (e.g., His-tag), immobilized metal affinity chromatography (IMAC) can be employed.

  • Size exclusion chromatography: As a final polishing step to achieve higher purity and separate protein aggregates.

Activity assessment throughout purification is essential using spectroscopic methods to monitor the integrity of the heme centers, which are crucial for CYB561 function.

How can researchers accurately measure the redox properties of recombinant CYB561?

Characterizing the redox properties of recombinant CYB561 requires multiple complementary techniques:

  • Spectroscopic methods: UV-visible spectroscopy enables monitoring of the characteristic absorption bands of the heme centers during redox titrations. The partially reduced Cytochrome b561 shows distinctive spectral features that help determine the reduction state of each heme center .

  • Redox titration experiments: These should be performed under anaerobic conditions using various reductants (including ascorbate) and analyzed using complex models that account for the presence of multiple redox centers .

  • Electron Paramagnetic Resonance (EPR) spectroscopy: This technique provides valuable information about the electronic structure of the heme centers. For mouse CYB561D1, EPR revealed that both hemes exhibit a highly asymmetric low-spin (HALS) character, which may differ in pig orthologs and should be specifically characterized .

The following table summarizes typical redox properties observed in different CYB561 proteins that can serve as a reference for pig CYB561 analysis:

CYB561 TypeExpression SystemHigh-Affinity Asc Binding Site (mM)Low-Affinity Asc Binding Site (mM)Reduction Potentials (mV)EPR Signal (g Value)
E highE low
Bt_CYB561A1none??15060
Bt_CYB561A1E.coli0.00530.39417181
Mm_CYB561A1S.cerevisiae0.0161.2416020

What spectroscopic techniques are most informative for structural characterization of CYB561?

Multiple spectroscopic approaches provide complementary structural information about recombinant CYB561:

  • Circular dichroism (CD) spectroscopy: This technique has been used to assess the secondary structure content and to investigate potential electronic interactions between the two heme-b centers. For mouse CYB561D1, no electronic interaction between heme centers was observed , providing insights into their independent functioning.

  • UV-visible absorption spectroscopy: The characteristic absorption bands of reduced and oxidized heme groups provide information about their coordination environment and redox state.

  • Electron paramagnetic resonance (EPR) spectroscopy: This technique provides detailed information about the electronic structure of paramagnetic species, such as oxidized heme-iron centers. In mouse CYB561D1, EPR revealed that both hemes exhibited highly asymmetric low-spin (HALS) character, without the rhombic heme environments (signals around gz = 3.16) observed in other CYB561 proteins .

  • X-ray crystallography or cryo-electron microscopy: While challenging for membrane proteins, these techniques provide the most detailed structural information when successful. For CYB561 proteins without available structures, homology modeling based on related proteins with known structures can provide valuable structural insights .

How does CYB561 function in cancer progression, and what mechanisms underlie these effects?

CYB561 plays significant roles in cancer biology through multiple mechanisms:

  • Support of neuroendocrine differentiation: CYB561 is upregulated in metastatic and neuroendocrine prostate cancer (NEPC) compared to normal prostate epithelia . This upregulation contributes to the neuroendocrine phenotype associated with aggressive castration-resistant prostate cancer.

  • Paracrine signaling: CYB561 is involved in neuropeptide activation and subsequent paracrine signaling that supports tumor growth. Experiments with conditioned media from control and CYB561-knockdown prostate cancer cells showed that knockdown of CYB561 reduced the ability of secreted factors to support the growth of other prostate cells .

  • Iron metabolism regulation: CYB561 contributes to cellular iron homeostasis, with knockdown experiments showing:

    • Decreased Fe²⁺ levels

    • Upregulation of transferrin receptor (TFRC) expression

    • Downregulation of ferritin (FTH1) and ferroportin (FPN1)

These changes in iron metabolism may influence multiple cancer-related processes, including cell proliferation, DNA synthesis, and oxidative stress responses.

What are the effects of CYB561 knockdown on cancer cell phenotypes?

Knockdown of CYB561 has demonstrated significant effects on cancer cell behavior, particularly in aggressive prostate cancer models:

  • Reduced proliferation: PC-3 prostate cancer cells with CYB561 knockdown showed decreased proliferation rates compared to control cells in both trypan blue exclusion assays and direct cell proliferation assays .

  • Decreased colony formation: CYB561 knockdown resulted in fewer and smaller colonies in colony formation assays, indicating reduced transformative ability and capacity to survive at very low cell densities .

  • Impaired migration: In wound-healing assays, CYB561 knockdown cells exhibited slower migration rates with lower percentage of wound closure compared to control cells .

  • Altered iron metabolism: CYB561 knockdown decreased intracellular Fe²⁺ concentration and altered the expression of iron regulatory genes, suggesting that CYB561's role in iron homeostasis may contribute to its effects on cancer cell phenotypes .

  • Disrupted paracrine signaling: Conditioned media from CYB561 knockdown cells had reduced ability to support the survival and proliferation of other prostate cell lines, indicating that CYB561 contributes to the production or activation of paracrine factors that support tumor growth .

How do the functional properties of pig CYB561 compare with those of other mammalian species?

While specific data on pig CYB561 is limited in our search results, comparative analysis of CYB561 proteins across mammalian species reveals important patterns:

  • Conservation of core structure: The six transmembrane domains and four histidine residues coordinating the two heme-b centers are highly conserved across species, suggesting functional conservation .

  • Species-specific variations in redox properties: As shown in the comparative table below, there are measurable differences in the redox properties among bovine and mouse CYB561 proteins:

CYB561 TypeSpeciesReduction Potentials (mV)Ascorbate Binding Affinity (mM)
E highE low
CYB561A1Bovine17181
CYB561A1Mouse16020

This suggests that while the core functions are preserved, species-specific optimizations may exist that could be relevant when working with pig CYB561 .

  • Expression pattern differences: The tissue-specific expression patterns of CYB561 proteins vary somewhat across species, potentially reflecting specialized physiological roles in different organisms.

For pig-specific studies, researchers should be aware that these species differences may affect experimental design and interpretation, particularly for pharmacological or biochemical studies that depend on precise redox parameters.

What structural differences exist between pig CYB561 and human CYB561 that might impact translational research?

When considering pig CYB561 as a model for human applications, researchers should be aware of several potential structural differences that might impact translational research:

  • Amino acid sequence variations: While the functional domains are highly conserved, species-specific variations in non-critical regions may affect protein-protein interactions, post-translational modifications, or regulatory mechanisms.

  • Post-translational modification sites: Differences in glycosylation, phosphorylation, or other modifications could affect protein stability, localization, or interaction with other cellular components.

  • Heme coordination environment: Minor differences in the amino acids surrounding the conserved histidine residues could alter the electronic properties of the heme centers, potentially affecting their redox potentials and electron transfer rates.

  • Ascorbate binding sites: Variations in the structure of ascorbate binding sites could result in different binding affinities and response profiles to ascorbate, as observed between bovine and mouse CYB561A1 .

These structural differences should be carefully considered when designing experiments using pig CYB561 as a model for human disease or when developing therapeutic approaches targeting CYB561. Homology modeling and careful biochemical characterization of pig CYB561 compared to human orthologs would be valuable for translational research applications.

How can recombinant CYB561 be used as a tool to study iron metabolism in health and disease?

Recombinant CYB561 serves as a valuable research tool for investigating iron metabolism based on its established role in cellular iron homeostasis:

  • Ferrireductase activity studies: Recombinant CYB561 can be used in in vitro systems to study the reduction of Fe³⁺ to Fe²⁺, a critical step in cellular iron utilization. This can help elucidate the molecular mechanisms underlying iron metabolism disorders.

  • Interaction with iron regulatory proteins: Using techniques such as co-immunoprecipitation or proximity labeling with recombinant CYB561 can identify novel interaction partners involved in iron sensing, transport, or storage.

  • Disease models: Recombinant CYB561 can be used to restore function in cellular or animal models where endogenous CYB561 has been knocked down or mutated, allowing for the assessment of iron metabolism in various disease contexts.

  • Structure-function studies: Site-directed mutagenesis of recombinant CYB561 can help identify critical residues involved in iron metabolism, providing insights into mechanistic aspects of iron homeostasis.

Experimental data demonstrates that CYB561 knockdown affects iron metabolism by decreasing intracellular Fe²⁺ concentration while altering the expression of iron regulatory genes, including increased transferrin receptor (TFRC) expression and decreased ferritin (FTH1) and ferroportin (FPN1) expression . These findings highlight the potential of CYB561 as a research tool for studying iron homeostasis mechanisms.

What are the most promising approaches for targeting CYB561 in cancer therapy based on current research?

Current research suggests several promising approaches for targeting CYB561 in cancer therapy:

  • RNA interference (RNAi)-based therapeutics: Knockdown of CYB561 using shRNA has demonstrated significant anti-cancer effects in prostate cancer models, including reduced proliferation, decreased colony formation, and impaired migration . Development of siRNA or shRNA delivery systems specifically targeting CYB561 could represent a viable therapeutic approach.

  • Small molecule inhibitors: Designing small molecules that inhibit CYB561's electron transport or ferrireductase activity could disrupt its function in supporting cancer cell growth. Structure-based drug design using homology models of CYB561 could facilitate the identification of potential binding pockets.

  • Targeting iron metabolism: Since CYB561 functions in iron homeostasis, combinatorial approaches targeting multiple components of iron metabolism could enhance therapeutic efficacy. This might involve combining CYB561 inhibition with iron chelators or other modulators of iron metabolism.

  • Disruption of paracrine signaling: CYB561's role in activating neuropeptides involved in paracrine signaling suggests that targeting this pathway could reduce tumor-supporting microenvironments. Blocking either CYB561 or downstream neuropeptide receptors could be effective in cancers where this mechanism is active.

  • Biomarker development: Expression levels of CYB561 have been associated with poor prognosis in breast cancer and increased in neuroendocrine prostate cancer . This suggests potential utility as a prognostic biomarker for patient stratification or treatment selection.

For translational applications, researchers should prioritize validation of these approaches in physiologically relevant models, including patient-derived xenografts or organoids, before advancing to clinical development.

What are the major challenges in expressing and purifying functional recombinant CYB561, and how can they be overcome?

Working with membrane proteins like CYB561 presents several technical challenges:

  • Low expression levels: Membrane protein overexpression often leads to toxicity or inclusion body formation.

    • Solution: Use tightly controlled inducible expression systems and optimize induction conditions (temperature, inducer concentration, duration). Expression in specialized hosts like C41/C43 E. coli strains or Pichia pastoris may improve yields for mammalian membrane proteins.

  • Proper membrane integration: Ensuring correct folding and membrane insertion is critical for function.

    • Solution: Consider using eukaryotic expression systems like yeast (S. cerevisiae) that have been successful for mouse CYB561D1 . These systems provide a more native-like membrane environment for proper folding.

  • Maintaining protein stability during purification: Membrane proteins often denature when removed from their lipid environment.

    • Solution: Screen multiple detergents to identify those that maintain CYB561 stability. Consider purification approaches that maintain a lipid-like environment, such as styrene-maleic acid lipid particles (SMALPs) or nanodiscs.

  • Preserving heme incorporation: The functional integrity of CYB561 depends on proper incorporation of two heme-b groups.

    • Solution: Supplement expression media with δ-aminolevulinic acid (ALA), a heme precursor, and ensure sufficient iron availability. Monitor heme incorporation spectroscopically throughout purification.

  • Assessing functional integrity: Verifying that the purified protein retains native functionality.

    • Solution: Develop robust assays for electron transfer activity, such as monitoring ascorbate oxidation or reduction of artificial electron acceptors. Confirm proper redox properties through techniques like redox titrations and EPR spectroscopy .

How can researchers accurately determine the in vivo functions and interactions of CYB561 in complex cellular environments?

Unraveling CYB561's functions in complex cellular contexts requires multifaceted approaches:

  • CRISPR/Cas9-mediated genome editing: Generate precise knockout or knock-in models to study CYB561 function in physiologically relevant contexts.

    • Knockout studies in cancer cell lines have revealed CYB561's role in supporting cell proliferation, colony formation, and migration .

    • Knock-in approaches with tagged versions can enable visualization of subcellular localization and dynamics.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 fused to CYB561 can identify proximal proteins in living cells, revealing potential interaction partners and functional pathways.

    • This approach could help identify additional components of the iron metabolism machinery that interact with CYB561.

  • Live-cell imaging with fluorescent reporters: Monitor iron dynamics and redox states in real-time in cells with modified CYB561 expression.

    • Fluorescent iron sensors combined with CYB561 manipulation can reveal the temporal dynamics of CYB561-mediated iron metabolism.

  • Conditional expression systems: Tetracycline-inducible or other regulated systems allow temporal control of CYB561 expression to study acute versus chronic effects.

    • This approach can help distinguish direct effects from compensatory responses.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from cells with altered CYB561 expression to build comprehensive functional networks.

    • Studies have shown that CYB561 knockdown affects iron regulatory gene expression patterns, suggesting complex regulatory networks .

  • Conditioned media experiments: As demonstrated in prostate cancer studies, analyzing how secreted factors from cells with altered CYB561 expression affect other cells can reveal paracrine signaling roles .

    • These experiments have shown that media from CYB561 knockdown cells has reduced ability to support the growth of other prostate cell lines.

What emerging technologies might advance our understanding of CYB561 structure-function relationships?

Several cutting-edge technologies show promise for deepening our understanding of CYB561:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM for membrane proteins could enable determination of high-resolution structures of CYB561 in different conformational states, providing insights into electron transfer mechanisms.

  • Time-resolved spectroscopy: Ultrafast spectroscopic techniques can capture transient states during electron transfer, revealing the kinetics and thermodynamics of CYB561-mediated electron movement across membranes.

  • Single-molecule techniques: Methods like single-molecule FRET could monitor conformational changes associated with electron transfer in real-time, providing dynamic information not available from static structural studies.

  • Molecular dynamics simulations: Advanced computational approaches can model electron transfer pathways through CYB561 and predict how sequence variations might affect function, complementing experimental approaches.

  • In-cell NMR spectroscopy: This emerging technique allows for structural studies in intact cells, potentially revealing how the cellular environment influences CYB561 structure and function.

  • Nanobody-based probes: Developing highly specific nanobodies against CYB561 could enable visualization of its dynamics in living cells and potentially modulate its function in a conformation-specific manner.

These technologies could help resolve unanswered questions about how the two heme centers in CYB561 cooperate in electron transfer and how structural features contribute to ascorbate binding and specificity.

How might comparative studies across species contribute to therapeutic applications targeting CYB561?

Cross-species comparative studies of CYB561 offer valuable insights for therapeutic development:

  • Conservation analysis: Identifying highly conserved regions across species can reveal functionally critical domains that might serve as optimal therapeutic targets. Conversely, species-specific variations might indicate regions involved in specialized functions or regulatory interactions.

  • Animal model selection: Understanding differences between human and animal CYB561 orthologs helps select the most appropriate preclinical models for therapeutic testing. Pig models might be particularly valuable if pig CYB561 closely resembles human orthologs in key functional aspects.

  • Selective targeting: Species differences in CYB561 structure could be exploited to design highly selective inhibitors that target human-specific features, potentially reducing off-target effects.

  • Evolutionary insights: Tracing the evolutionary history of CYB561 across species can reveal functional adaptations that might inform therapeutic strategies targeting specific aspects of its function.

  • Translational biomarkers: Identifying conserved expression patterns or regulatory mechanisms across species can help develop robust biomarkers for patient stratification or treatment monitoring.

Cross-species studies have already revealed variations in redox properties and ascorbate binding affinities between bovine and mouse CYB561A1 , suggesting that similar differences might exist in pig and human orthologs. These differences could have significant implications for translating preclinical findings to human applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.