Recombinant Pig Cytochrome b5 (CYB5A)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Porcine Metabolism

CYB5A interacts with cytochrome P450 (CYP) enzymes to modulate metabolic pathways:

  • Skatole Metabolism: Co-expression with CYP2A19, CYP2E1, and CYP2C49 enhances the production of skatole metabolites like 6-hydroxy-3-methylindole (6-OH-3MI), critical for understanding boar taint .

  • Androstenone Regulation: A G>T polymorphism at position -8 in the CYB5A promoter reduces plasma androstenone levels in pigs at 90 kg live weight (P = 0.006) and lowers fat skatole concentrations at 115 kg (P = 0.028) .

Applications in Research

  • Enzyme Activity Studies: Used to investigate electron transfer mechanisms in CYP-mediated reactions .

  • Biochemical Assays: SDS-PAGE analysis confirms protein purity and stability .

  • Genetic Studies: Polymorphism analyses link CYB5A variants to metabolic traits in swine .

Comparative Analysis of Recombinant CYB5A Variants

SpeciesTagExpression SystemKey Application
Pig (Sus scrofa)HisE. coliSkatole metabolism
BovineHisE. coliLipid oxidation studies
Rhesus MacaqueHis-Fc-AviHEK293Structural biology

Research Implications

  • Weight-Dependent Effects: The T allele’s impact on androstenone/skatole levels varies with pig weight, suggesting dynamic regulatory mechanisms .

  • CYP Synergy: CYB5A increases catalytic efficiency of CYP2A19 in skatole hydroxylation by 42%, highlighting its role as a redox partner .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYB5A; CYB5; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-134
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
CYB5A
Target Protein Sequence
AEQSDKAVKYYTLEEIQKHNNSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTFIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISAL VVSLMYHFYTSEN
Uniprot No.

Target Background

Function
Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for various membrane-bound oxygenases.
Gene References Into Functions
  1. Investigation of porcine CYB5 gene mutations, expression analysis, and identification of genetic polymorphisms related to androstenone levels in testes. PMID: 16104384
  2. The c.-8G>T SNP in the CYB5A gene exhibits a significant, albeit modest, effect on boar taint in male pigs. It may be useful in certain breeds as part of a marker-assisted selection program for low boar taint pigs. PMID: 18162105
  3. This research demonstrates the differential effects of two CYB5 forms on the three activities of porcine CYP17A1, indicating that CYB5B does not stimulate the andien-beta synthase activity of CYP17A1. PMID: 19101629
Database Links
Protein Families
Cytochrome b5 family
Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.; [Isoform 2]: Cytoplasm.

Q&A

What is cytochrome b5 (CYB5A) and what are its key functions in porcine metabolism?

Cytochrome b5 is a heme-containing protein that plays a crucial role in electron transport chains in cellular metabolism. In pigs, as in other mammals, CYB5A (the microsomal isoform) participates primarily in redox reactions, accepting electrons from cytochrome b5 reductase (CYB5R) and transferring them via its heme group to other enzymes or substrates. The protein is critical in several metabolic pathways including fatty acid desaturation, cholesterol biosynthesis, and drug metabolism through interaction with cytochrome P450 enzymes .

Experimental evidence demonstrates that CYB5 acts as an electron transport protein, accepting electrons from CYB5R and passing them via its heme to the molybdenum cofactor (Moco) of mitochondrial amidoxime reducing component (mARC) . This electron transfer capability makes CYB5A essential for numerous reductive metabolic processes in porcine cells.

How can researchers distinguish between microsomal (CYB5A) and mitochondrial (CYB5B) isoforms in experimental systems?

Distinguishing between CYB5A and CYB5B requires attention to their subcellular localization, functional characteristics, and molecular properties:

What expression systems are most effective for producing recombinant pig CYB5A?

The most effective and widely used expression system for recombinant pig CYB5A is Escherichia coli, which offers several advantages:

  • High protein yield: E. coli systems typically produce significant quantities of recombinant protein.

  • Established protocols: Well-documented transformation and expression procedures exist, such as using the pET expression system with BL21(DE3) competent cells .

  • Optimization strategies: Expression conditions can be fine-tuned by:

    • Inducing with IPTG at lower temperatures (4-8°C) to enhance proper folding and heme incorporation

    • Using rich media supplemented with δ-aminolevulinic acid to improve heme biosynthesis

    • Optimizing induction timing based on culture density (OD₆₀₀ ≈ 1.5)

The expression construct should contain the coding sequence inserted into an appropriate vector (such as pET19b) using suitable restriction sites (e.g., NdeI and BamHI) . After transformation and culture, protein expression is typically induced with IPTG under controlled temperature conditions.

What purification methods yield the highest activity for recombinant pig CYB5A?

To maintain maximum enzymatic activity, recombinant pig CYB5A requires careful purification:

  • Initial preparation: After IPTG induction and cell harvesting, cells should be maintained at cold temperatures (4-8°C) during all purification steps .

  • Cell lysis: Gentle lysis using lysozyme (approximately 3 mg/ml) in appropriate buffer (e.g., 50 mM NaPi, pH 7.4, 500 mM NaCl, 20 mM MgCl₂, 1 mM PMSF) preserves protein structure .

  • Chromatography techniques:

    • Metal affinity chromatography (if His-tagged)

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

  • Quality control: The purified protein should be evaluated for:

    • Heme content using difference spectroscopy of oxidized and NADH-reduced protein

    • Functional activity through enzyme assays

    • Purity by SDS-PAGE and spectroscopic analysis

Maintaining low temperature and including protease inhibitors throughout the purification process helps preserve the native conformation and activity of the recombinant protein.

How does the heme group influence the electron transfer capability of pig CYB5A?

The heme prosthetic group is absolutely essential for the electron transfer function of pig CYB5A. Research has demonstrated that:

  • Heme dependency: Studies with apo-CYB5 (heme-free form) have confirmed that N-reductive catalysis strictly depends on the presence of heme . The heme group serves as the electron carrier that accepts electrons from CYB5R and transfers them to the final acceptor.

  • Preparation of apo-CYB5: Researchers can prepare apo-CYB5 using the methyl ethyl ketone (2-butanone) method under acidic conditions (pH 2.5) . This involves:

    • Maintaining the protein solution on ice

    • Adjusting to pH 2.5 with 0.1 M HCl

    • Adding equal volume of cold 2-butanone

    • Separating the heme-containing butanone phase from the aqueous phase with apo-enzyme

    • Buffer exchange to restore physiological conditions

  • Spectroscopic confirmation: The absence of characteristic absorption peaks at 557, 527, and 425 nm confirms successful heme removal .

  • Functional consequences: Comparing the activities of holo-CYB5A (with heme) and apo-CYB5A (without heme) provides direct evidence of the heme's role in electron transfer. Unlike some P450-catalyzed reactions where apo-CYB5 can still exert allosteric effects, the N-reductive system requires heme for electron transfer functionality .

What are the effects of genetic polymorphisms on pig CYB5A structure and function?

Genetic polymorphisms can significantly impact CYB5A structure and function. While specific pig CYB5A SNP data is limited, research on human CYB5B variants offers insights applicable to porcine studies:

  • Known variants: Four nonsynonymous SNPs have been investigated in human CYB5B:

    • c.5C>T (rs117949766) resulting in S2F substitution

    • c.41A>G (rs79522540) resulting in D14G substitution

    • c.46A>G (rs79729055) resulting in K16E substitution

    • c.64A>G (rs77374917) resulting in T22A substitution

  • Expression and characterization: These variants can be generated through PCR mutagenesis using primers carrying the desired mutation, with expression in E. coli for functional studies .

  • Functional impact: Studies suggest that some amino acid substitutions in cytochrome b5 may affect protein stability, heme binding, or interaction with redox partners, potentially altering electron transfer efficiency.

  • Research approach: To investigate potential SNPs in pig CYB5A, researchers should:

    • Screen genomic databases for pig CYB5A polymorphisms

    • Create recombinant variants through site-directed mutagenesis

    • Analyze effects on protein structure, heme content, and enzymatic activity

    • Reconstitute with partner proteins to assess functional consequences

How can researchers effectively reconstitute a functional pig CYB5A system for in vitro studies?

Reconstituting a functional pig CYB5A system requires careful combination of multiple components:

  • Component preparation:

    • Recombinant CYB5A with verified heme content

    • Recombinant CYB5R with confirmed FAD content

    • Appropriate substrate for the reaction being studied

    • Optimal buffer system (typically phosphate buffer, pH 7.4)

    • NADH as electron donor

  • Determination of component quality:

    • CYB5A heme content: Assessed through difference spectroscopy of oxidized and NADH-reduced protein

    • CYB5R FAD content: Determined by absorption at 450 nm

  • Reconstitution parameters:

    • Component ratios: Optimal molar ratios of CYB5A:CYB5R typically range from 1:1 to 10:1

    • Temperature: Usually 30-37°C for mammalian systems

    • Reaction initiation: Typically started by addition of NADH after pre-incubation of other components

  • Activity verification: The reconstituted system should be validated through appropriate activity assays, such as:

    • Cytochrome c reduction

    • Superoxide production in the presence of air and excess NADH

    • Reduction of specific N-hydroxylated substrates

What methodologies are most effective for studying the role of pig CYB5A in N-reductive metabolism?

Studying the N-reductive role of pig CYB5A requires specialized methodologies:

  • In vitro reconstitution studies:

    • Three-component system: Recombinant CYB5A, CYB5R, and mARC proteins

    • Substrate selection: N-hydroxylated compounds (e.g., benzamidoxime)

    • Analysis methods: HPLC or LC-MS/MS to quantify reaction products

  • Cell-based approaches:

    • siRNA-mediated down-regulation of CYB5A in appropriate cell lines

    • Overexpression of pig CYB5A in cells with low endogenous expression

    • Transfection with c-myc tagged constructs for localization studies

  • Localization and interaction studies:

    • Confocal microscopy using fluorescently labeled antibodies

    • Co-immunoprecipitation to identify protein-protein interactions

    • Cell fractionation to determine subcellular distribution

  • Functional characterization:

    • Spectroscopic analysis showing characteristic reduced cytochrome b peaks at 557, 527, and 425 nm

    • Electron transfer assays measuring reduction of cytochrome c

    • Direct measurement of N-reductive activity with model substrates

How does pig CYB5A interact with cytochrome P450 enzymes in xenobiotic metabolism?

Pig CYB5A plays complex roles in modulating cytochrome P450-mediated xenobiotic metabolism:

  • Mechanisms of interaction:

    • Direct electron transfer: CYB5A can provide the second electron to P450 enzymes in the catalytic cycle

    • Allosteric effects: CYB5A may cause conformational changes in P450 enzymes that enhance their activity

    • Complex formation: CYB5A forms transient complexes with P450 enzymes and their reductases

  • Experimental approaches:

    • Reconstituted systems combining recombinant pig CYB5A with specific P450 isoforms

    • Kinetic analysis comparing P450 activity with and without CYB5A

    • Spectral binding studies to characterize protein-protein interactions

  • Research applications:

    • Drug metabolism studies: Recombinant P450 enzymes with CYB5A represent useful test systems for studies requiring high levels of individual enzymatic activities

    • Reaction phenotyping: CYB5A influences may help identify specific P450 enzymes involved in metabolic pathways

    • Inhibition studies: Evaluating how CYB5A affects inhibitor potency with various P450 enzymes

  • Analytical considerations:

    • Maintaining physiologically relevant ratios of CYB5A to P450

    • Accounting for membrane environment effects on protein interactions

    • Considering species differences in CYB5A-P450 interactions

What quality control parameters should be monitored when working with recombinant pig CYB5A?

Rigorous quality control is essential when working with recombinant pig CYB5A:

  • Spectroscopic criteria:

    • Properly folded CYB5A shows characteristic reduced spectrum with alpha, beta, and Soret peaks at 557, 527, and 425 nm respectively

    • The A280/A415 ratio indicates heme incorporation efficiency

    • Difference spectrum between oxidized and reduced forms confirms functional heme

  • Heme content determination:

    • Quantitative analysis through pyridine hemochromogen assay

    • Difference spectroscopy of oxidized and NADH-reduced protein

    • Comparison to established standards

  • Functional assays:

    • Electron transfer capability measured through cytochrome c reduction

    • NADH oxidation rates

    • Specific substrate reduction (for pathway-specific studies)

  • Protein characterization:

    • SDS-PAGE for purity assessment

    • Mass spectrometry for identity confirmation

    • Western blotting using anti-CYB5A antibodies

How can differential gene expression analysis inform research on pig CYB5A?

Differential gene expression analysis provides valuable insights into pig CYB5A regulation and function:

  • Experimental design considerations:

    • Tissue selection: CYB5A expression varies across tissues

    • Developmental stages: Expression patterns may change during growth

    • Experimental conditions: Various treatments may alter expression

  • Analysis methodologies:

    • RNA-Seq or microarray for genome-wide expression patterns

    • RT-PCR for targeted gene expression analysis

    • Statistical analysis using established methods (e.g., limma procedure)

  • Data interpretation:

    • Log fold change (logFC) indicates magnitude of expression differences

    • False Discovery Rate (FDR) procedures control for multiple testing

    • Non-parametric tests (e.g., Kruskal-Wallis) confirm expression differences

  • Co-expression networks:

    • Identification of genes with correlated expression patterns

    • Pathway enrichment analysis to identify biological processes

    • Identification of potential regulatory mechanisms

A sample data table from differential expression analysis might resemble:

GeneDescriptionlogFCFDRK-W P-value
CYB5Acytochrome b5 type A0.738.077E-060.015
COX4I1cytochrome c oxidase subunit IV isoform 10.771.139E-050.059
AASDHPPTaminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase-0.620.0090.011

(Adapted from similar differential expression data)

What strategies can overcome common challenges in expressing functional recombinant pig CYB5A?

Researchers frequently encounter challenges when expressing recombinant pig CYB5A that can be addressed through specialized strategies:

  • Insufficient heme incorporation:

    • Supplement growth medium with δ-aminolevulinic acid (precursor for heme biosynthesis)

    • Lower induction temperature to 4-8°C to slow protein synthesis and improve folding

    • Add hemin directly to culture medium prior to induction

  • Poor solubility:

    • Express as fusion protein with solubility-enhancing tags

    • Optimize induction conditions (lower IPTG concentration, reduced temperature)

    • Use specialized E. coli strains designed for membrane protein expression

  • Degradation during purification:

    • Maintain cold temperatures (4-8°C) throughout all purification steps

    • Include protease inhibitors (e.g., 1 mM PMSF) in lysis and purification buffers

    • Minimize purification time with efficient protocols

  • Low enzymatic activity:

    • Verify heme content through spectroscopic analysis

    • Optimize buffer conditions for stability and activity

    • Ensure proper storage conditions (typically -80°C in glycerol-containing buffer)

How can pig CYB5A research inform understanding of human drug metabolism pathways?

Research on pig CYB5A offers valuable insights for human applications:

  • Comparative metabolism studies:

    • Pigs are considered good models for human drug metabolism due to similar CYB5A functions

    • Recombinant pig CYB5A enables controlled studies of specific enzymatic interactions

    • Different CYB5A isoforms can be compared to understand species-specific metabolism

  • Application to drug development:

    • Recombinant systems containing pig CYB5A represent useful test systems for preclinical reaction phenotyping and inhibition studies

    • Understanding CYB5A's role in drug metabolism helps predict potential drug-drug interactions

    • Species differences in CYB5A function inform the translation of preclinical data to humans

  • N-reductive metabolism pathways:

    • The mARC-containing N-reductive system with CYB5A is important for activation/deactivation of numerous drugs

    • Research on pig CYB5A in N-reduction provides a model for human metabolism of N-hydroxylated compounds

  • Polymorphism effects:

    • Studies of SNP effects in pig CYB5A may predict functional consequences of human polymorphisms

    • Recombinant variant proteins can be analyzed for altered metabolic activity

What experimental approaches best demonstrate the role of pig CYB5A in cellular redox balance?

Understanding pig CYB5A's role in maintaining cellular redox balance requires specialized experimental approaches:

  • Direct measurement of electron transfer:

    • Spectrophotometric assays measuring cytochrome c reduction rates

    • Oxygen consumption measurements using Clark-type electrodes

    • Superoxide production assays in the presence of excess NADH

  • Cellular models:

    • siRNA-mediated knockdown of CYB5A to observe effects on redox balance

    • Overexpression of wild-type or mutant CYB5A in appropriate cell lines

    • Measurement of cellular redox status using fluorescent indicators

  • Oxidative stress studies:

    • Exposure of CYB5A-modified cells to oxidative stressors

    • Assessment of ROS levels, antioxidant enzyme activities, and oxidative damage markers

    • Comparison of wild-type and CYB5A-deficient cells under stress conditions

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation to identify redox partners

    • Fluorescence resonance energy transfer (FRET) to observe real-time interactions

    • Cross-linking studies to capture transient redox complexes

How might emerging technologies enhance our understanding of pig CYB5A function?

Emerging technologies offer new opportunities for pig CYB5A research:

  • CRISPR-Cas9 gene editing:

    • Generation of precise CYB5A mutations in cell lines

    • Creation of specific polymorphic variants

    • Development of CYB5A knockout models for functional studies

  • Advanced structural biology:

    • Cryo-electron microscopy to visualize CYB5A complexes with partner proteins

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Molecular dynamics simulations to predict effects of mutations

  • Single-cell technologies:

    • Single-cell RNA-seq to reveal cell-specific CYB5A expression patterns

    • Spatial transcriptomics to map CYB5A expression in tissue contexts

    • Live-cell imaging of fluorescently tagged CYB5A to track subcellular dynamics

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Network analysis to position CYB5A within broader metabolic pathways

    • Mathematical modeling of electron transfer systems

What are the key unresolved questions regarding pig CYB5A structure-function relationships?

Despite significant advances, several important questions about pig CYB5A remain unanswered:

  • Structural determinants of partner specificity:

    • Which protein domains determine specific interactions with different partners?

    • How does membrane anchoring influence functional interactions?

    • What structural features determine isoform-specific functions?

  • Regulatory mechanisms:

    • How is CYB5A expression regulated in different porcine tissues?

    • What post-translational modifications affect CYB5A function?

    • How do cellular redox conditions influence CYB5A activity?

  • Evolutionary considerations:

    • How have CYB5A structure and function evolved across species?

    • What selective pressures have shaped species-specific features?

    • How do these differences impact the use of pigs as models for human metabolism?

  • Therapeutic implications:

    • Could CYB5A be a target for modulating drug metabolism?

    • How might CYB5A polymorphisms affect individual responses to drugs?

    • Could recombinant CYB5A systems be used for drug detoxification applications?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.