Recombinant Pig D (1A) dopamine receptor (DRD1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Dopamine Signaling

DRD1 mediates dopamine signaling via coupling to Gαs proteins, which stimulate adenylyl cyclase (AC) activity, increasing intracellular cAMP levels. This pathway regulates neuronal excitability, calcium channel activity, and neurogenic gene expression .

Key Functional Pathways

  • cAMP/PKA Signaling: Activation of DRD1 enhances cAMP production, triggering PKA-mediated phosphorylation of downstream targets (e.g., calcium channels) .

  • Calcium Modulation: Indirectly affects calcium stores and L-type/N/P-type calcium channels via PKA .

  • Neurodevelopmental Regulation: Constitutive activity in neural stem cells (NSCs) influences proliferation and differentiation, as shown in human and cerebral organoid models .

Research Applications and Tools

Recombinant pig DRD1 is utilized in biochemical assays, structural studies, and drug discovery. Below are critical tools and findings:

ELISA Kits for Quantification

The Porcine D(1A) Dopamine Receptor ELISA Kit (Assay Genie, SKU: PREB0351) enables precise quantification of DRD1 in porcine samples (serum, plasma, tissue homogenates) .

ComponentDescription
Detection MethodSandwich ELISA with anti-DRD1 antibodies
SensitivityOptimized for recombinant and endogenous DRD1 detection
Sample TypesSerum, plasma, cell culture supernatants, tissue lysates
Subunit InteractionsBinds DNAJC14 (chaperone) and DRD1IP (regulatory protein)

Antibody-Based Detection

Specific antibodies (e.g., Guinea pig Anti-D1 Dopamine Receptor Antibody, #ADR-001-GP) target the intracellular C-terminus (residues 372–385) for Western blot and immunohistochemistry .

AntibodyApplicationReactivityValidation
ADR-001-GPWB, IHCRat, Mouse, HumanPre-blocked peptide control
Boster Bio A00907WBHuman, Mouse, RatCross-reactivity tested

Disease Associations and Therapeutic Implications

DRD1 dysfunction is linked to neurological disorders:

  • Parkinson’s Disease: Reduced DRD1 signaling correlates with motor deficits .

  • Schizophrenia: Altered DRD1 expression contributes to cognitive and emotional symptoms .

  • Hypertension: Modulates renal Na⁺ transport and vasoactive hormone responses .

Recombinant pig DRD1 is critical for developing selective agonists/antagonists, particularly in cardiovascular and neurodegenerative disease models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
DRD1; D(1A dopamine receptor; Dopamine D1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MRTLNTSTMDGTGLVVERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNVTSLG KTTHNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN CQTTAGNGNPAECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTSTNAIET VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIASPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT
Uniprot No.

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins, which activate adenylyl cyclase.
Gene References Into Functions
  1. Research indicates that endocytosis of the beta(1)-adrenoceptor in renal proximal tubular cells is crucial for signal generation, while endocytosis of the proximal tubular D1 receptor is not. PMID: 16217657
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine.

Q&A

What is the structure and function of DRD1 in pigs compared to other species?

Pig DRD1, like its counterparts in other mammals, is a G protein-coupled receptor (GPCR) belonging to the dopamine receptor family. It contains seven transmembrane domains characteristic of GPCRs and shares substantial sequence homology with human DRD1. The receptor primarily couples with Gαs/olf proteins to activate adenylyl cyclase, resulting in increased intracellular cAMP and subsequent activation of protein kinase A (PKA) .

The DRD1 signaling cascade regulates various neuronal functions including synaptic plasticity and gene expression. In the brain, DRD1 is expressed in multiple regions including the prefrontal cortex, striatum, and hippocampus . While specific data on pig DRD1 is more limited, comparative genomic analysis suggests high conservation in key functional domains, particularly in transmembrane regions and ligand-binding pockets, with some species-specific variations in intracellular loops and C-terminal regions.

How is recombinant pig DRD1 typically produced for research applications?

Production of recombinant pig DRD1 involves several key steps and considerations:

Expression Systems:

  • Bacterial systems (E. coli): Suitable for receptor fragments but challenging for full-length GPCRs

  • Mammalian cell lines (HEK293, CHO): Provide native-like environment for proper folding and post-translational modifications

  • Insect cell systems (Sf9, Hi5): Balance between yield and proper modification

Production Protocol:

  • Isolate the pig DRD1 gene from porcine tissue or synthesize based on sequence data

  • Clone into an appropriate expression vector with affinity tags (His6, FLAG, etc.)

  • Transfect/transform the chosen expression system

  • Optimize expression conditions (temperature, induction parameters)

  • Extract and purify using affinity chromatography followed by size exclusion

Quality Control:

  • Western blot analysis using validated antibodies (expected MW ~50 kDa)

  • Ligand binding assays to confirm functionality

  • Proper glycosylation assessment if using eukaryotic systems

For functional studies, surface expression in mammalian systems is generally preferred to ensure proper receptor folding and post-translational modifications essential for native-like binding and signaling properties.

What methods can verify expression and functionality of recombinant pig DRD1?

Comprehensive verification requires multiple complementary approaches:

Expression Verification:

  • Western blot analysis using validated anti-DRD1 antibodies. The expected molecular weight is approximately 50 kDa, though this may vary depending on post-translational modifications .

  • Immunocytochemistry to confirm membrane localization

  • Flow cytometry for quantitative assessment of surface expression

Functionality Verification:

  • cAMP accumulation assays: As DRD1 couples to Gαs/olf, stimulation with selective agonists should increase intracellular cAMP levels

  • Calcium mobilization assays: Though secondary to cAMP pathways, can provide additional functional data

  • ERK1/2 phosphorylation: DRD1 activation typically leads to downstream ERK phosphorylation

  • Radioligand binding assays: Using selective DRD1 ligands such as [³H]SCH-23390

A robust validation protocol should include dose-response curves with known DRD1 agonists and antagonists, comparing responses to those documented for human or rodent DRD1 to establish pharmacological similarities or differences specific to the pig receptor.

How does the constitutive activity of DRD1 impact experimental design, and how can it be measured?

Constitutive activity refers to the ability of a receptor to signal in the absence of ligand binding. Recent research has demonstrated that DRD1 exhibits significant constitutive activity that plays important roles in neural development and function .

Measuring DRD1 Constitutive Activity:

  • Baseline cAMP levels in DRD1-expressing cells versus controls

  • Effects of inverse agonists on reducing signaling below basal levels

  • BRET/FRET-based assays to detect ligand-independent conformational changes

Impact on Experimental Design:

  • Control experiments must account for baseline activity

  • Inverse agonists provide different information than neutral antagonists

  • Constitutive activity may vary between cell types and expression systems

Research has shown that DRD1 constitutive activity plays a crucial role in neural stem cell development. Inhibition of this constitutive activity (via inverse agonists or genetic manipulation) promotes neural stem cell proliferation while impeding differentiation . The A229T mutation in DRD1 has been shown to reduce constitutive activity, resulting in increased neural stem cell proliferation .

When designing experiments with recombinant pig DRD1, researchers should consider whether preserving or modulating this constitutive activity is important for their specific research questions, particularly in developmental studies.

What signaling pathways beyond canonical Gαs/cAMP are mediated by pig DRD1?

While DRD1 primarily signals through Gαs/olf to stimulate adenylyl cyclase and increase cAMP, several alternative pathways have been identified that may be relevant in pig models:

Non-canonical Signaling Pathways:

  • PKC-CBP Pathway: Recent research has identified that DRD1 can signal through the PKC-CBP pathway, which is particularly important in neural stem cell regulation . This pathway maintains a basal level of neurogenic gene expression under physiological conditions.

  • G Protein-Independent Signaling: DRD1 can activate certain pathways independent of G proteins, including β-arrestin-mediated signaling cascades.

  • Transactivation Mechanisms: DRD1 stimulation can lead to transactivation of receptor tyrosine kinases, expanding its signaling repertoire.

  • Heterodimeric Signaling: When DRD1 forms heterodimers with other receptors (particularly DRD2), unique signaling patterns emerge that differ from those of monomeric receptors .

The relative importance of these pathways may vary by cell type and brain region. For comprehensive characterization of pig DRD1 signaling, researchers should examine multiple downstream effectors including cAMP, Ca²⁺, ERK1/2, CREB phosphorylation, and gene expression changes, comparing responses to those observed with human DRD1 to identify potential species-specific signaling biases.

How does DRD1 expression change during pig neurodevelopment, and what are the functional implications?

Understanding developmental expression patterns of DRD1 in pigs provides insights into its roles in neurogenesis and circuit formation:

Developmental Expression Pattern:
While pig-specific data is limited, research on DRD1 in other species indicates that it appears during early embryonic development, before the formation of mature synaptic contacts . This suggests critical roles in neurodevelopmental processes.

Functional Implications:

  • Constitutive activity of DRD1 regulates the balance between neural stem cell proliferation and differentiation

  • Inhibition of DRD1 constitutive activity promotes neural stem cell maintenance and proliferation while hindering neurogenesis

  • These effects appear to be mediated through the PKC-CBP signaling pathway

Methodological Approaches for Developmental Studies:

  • Temporal expression profiling using RT-qPCR and Western blotting

  • In situ hybridization to map regional expression patterns

  • Single-cell RNA sequencing to identify cell type-specific expression

  • Pig cerebral organoids for studying DRD1 function in a 3D developmental context

Understanding the developmental trajectory of DRD1 expression in pigs can provide valuable insights for neurodevelopmental disorders, particularly those involving imbalances in neural progenitor proliferation versus differentiation, and may guide the timing of potential therapeutic interventions.

What are the optimal pharmacological tools for studying pig DRD1 function?

Selecting appropriate pharmacological tools requires understanding their selectivity profiles and experimental conditions:

DRD1-Selective Agonists:

  • SKF-38393: Partial agonist, widely used but has some D5R activity

  • SKF-81297: Full agonist with high potency

  • A-77636: Long-acting agonist

  • Dihydrexidine: High-efficacy agonist

DRD1-Selective Antagonists:

  • SCH-23390: Most commonly used, high affinity but also binds to 5-HT2 receptors

  • SCH-39166: More selective than SCH-23390

  • NNC-112: High affinity and selectivity

DRD1 Inverse Agonists:

  • These compounds reduce the constitutive activity of DRD1 and have been shown to promote neural stem cell proliferation

Recommended Usage Parameters:

CompoundWorking Concentration RangeSolubilityKey Considerations
SKF-383930.1-10 μMWater, DMSOLight sensitive
SKF-812970.01-1 μMWater, DMSOPrepare fresh solutions
SCH-233900.01-1 μMWater, DMSOConsider 5-HT2 activity at >1 μM
NNC-1120.001-0.1 μMDMSOHighly potent, use with caution

When using these compounds with pig DRD1, researchers should consider potential species differences in potency and efficacy, and validate key findings using multiple compounds to ensure receptor specificity. A major limitation remains the lack of compounds that can fully distinguish between DRD1 and the highly homologous D5R .

How can I optimize signaling assays for pig DRD1 to increase sensitivity and reproducibility?

Optimizing DRD1 signaling assays requires attention to multiple experimental parameters:

cAMP Assay Optimization:

  • Pre-treat with phosphodiesterase inhibitors (e.g., IBMX) for 15-30 minutes

  • Include forskolin controls to verify adenylyl cyclase functionality

  • For time-course studies, measure at 5, 15, and 30 minutes post-stimulation

  • Consider real-time measurements using FRET/BRET-based sensors

Phospho-protein Assays (ERK1/2, CREB):

  • Include phosphatase inhibitors in lysis buffers

  • Establish detailed time courses (rapid activation may be missed with single timepoints)

  • Normalize phospho-signals to total protein expression

General Optimization Strategies:

  • Cell Density Optimization:

    • Too high: Contact inhibition affects signaling

    • Too low: Insufficient signal-to-noise ratio

  • Serum Starvation Conditions:

    • Duration: Typically 4-24 hours

    • Serum concentration: 0-0.5% FBS

  • Technical Replication:

    • Minimum of 3-4 technical replicates per condition

    • At least 3 independent biological replicates

For studies examining DRD1 constitutive activity in neural stem cells or progenitors, additional considerations include the baseline proliferation rate of the cells and the duration of exposure to inverse agonists, as these parameters significantly impact the observable effects on cell proliferation and differentiation .

What are the key considerations for designing genetic manipulations of DRD1 in pig models?

Creating genetic models targeting pig DRD1 requires careful planning:

Knockout Strategies:

  • Complete gene knockout: CRISPR/Cas9 targeting of early exons

  • Conditional knockout: Cre-loxP system for tissue-specific or temporally controlled deletion

  • Domain-specific disruption: Targeted modification of specific functional domains

Knockin Approaches:

  • Reporter knockins: Fluorescent protein fusion for tracking expression

  • Point mutations: Introduction of specific mutations such as A229T to modulate constitutive activity

  • Humanized DRD1: Replacing pig DRD1 with human sequence for better translational models

Technical Considerations:

  • Efficiency of homology-directed repair in pig cells

  • Off-target effects of CRISPR/Cas9

  • Mosaicism in founder animals

  • Breeding strategies to establish homozygous lines

Validation Requirements:

  • Genomic verification by sequencing

  • Transcript analysis by RT-PCR

  • Protein expression assessment by Western blot

  • Functional validation through signaling assays

  • Phenotypic characterization including behavioral assessment

As demonstrated in human neural stem cell research, even single amino acid changes (like A229T) can significantly affect DRD1 constitutive activity and consequently impact neural stem cell proliferation , highlighting the importance of careful mutation design and comprehensive functional validation.

How might findings from pig DRD1 research translate to novel therapeutic approaches for neurological disorders?

Pig DRD1 research has significant translational potential due to greater physiological similarity to humans compared to rodent models:

Potential Therapeutic Applications:

  • Parkinson's Disease:

    • Development of selective DRD1 agonists with reduced desensitization profiles

    • DRD1 signaling pathways are critical in motor control and are disrupted in PD

    • Biased agonists that preferentially activate motor-enhancing pathways

  • Cognitive Disorders:

    • DRD1 signaling in the prefrontal cortex is crucial for working memory

    • Genetic variations in DRD1 expression are associated with cognitive performance

    • Compounds enhancing DRD1-mediated synaptic plasticity could improve cognitive function

  • Neurodevelopmental Interventions:

    • Targeting DRD1 constitutive activity to modulate neural stem cell proliferation

    • Potential approaches for conditions involving aberrant neurogenesis

    • Critical period interventions based on developmental DRD1 expression

The discovery that DRD1 constitutive activity regulates neural stem cell proliferation and differentiation opens new therapeutic possibilities for conditions involving imbalanced neurogenesis. Additionally, understanding the genetic factors that influence DRD1 expression and function in the prefrontal cortex may help stratify patients for personalized cognitive enhancement therapies .

What emerging technologies might advance our understanding of pig DRD1 structure-function relationships?

Several cutting-edge technologies are poised to revolutionize DRD1 research:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy: Determination of pig DRD1 structure in different activation states

  • Single-particle tracking: Monitoring DRD1 dynamics in native membranes

  • HDX-MS: Probing conformational changes upon ligand binding

Genetic and Cellular Technologies:

  • CRISPR-based approaches: Precise modification of key residues (as demonstrated with A229T mutation)

  • Advanced imaging: Super-resolution techniques for visualizing receptor complexes

  • Organoid technologies: Pig brain organoids for developmental studies

Computational Approaches:

  • Molecular dynamics simulations: Long-timescale modeling of pig DRD1 in membranes

  • Machine learning applications: Prediction of structure-activity relationships

  • Network pharmacology: Mapping the full DRD1 interactome

Human cerebral organoids have already proven valuable for studying DRD1 function in neurodevelopment , and pig-derived organoids could provide an even closer model to human brain development. The combination of precise genetic editing (as demonstrated with the A229T mutation) with advanced imaging and functional readouts in 3D organoid systems represents a particularly promising approach for understanding the complex roles of DRD1 in neural development and function.

How can researchers better understand the role of DRD1 in pig neural stem cell development and neurogenesis?

Understanding DRD1's role in pig neural stem cell development offers insights into both basic neurobiology and potential therapeutic applications:

Key Research Approaches:

  • In vitro pig NSC models:

    • Isolation and characterization of NSCs from pig embryonic/adult brain

    • Comparison of signaling pathways with human NSCs

  • Pig cerebral organoids:

    • Generation protocols optimized for pig cells

    • Evaluation of effects of DRD1 modulators on development

  • In vivo developmental studies:

    • Temporally controlled manipulation of DRD1 activity

    • Lineage tracing of DRD1-expressing progenitors

Key Questions to Address:

  • Is the constitutive activity of pig DRD1 comparable to that observed in human NSCs?

  • Does inhibition of DRD1 constitutive activity in pig models produce similar effects on NSC proliferation and differentiation as observed in human models?

  • Is the PKC-CBP pathway similarly involved in mediating these effects in pig NSCs?

Recent research has demonstrated that DRD1 constitutive activity regulates the balance between neural stem cell proliferation and differentiation in human models . Inhibition of this constitutive activity (through inverse agonists or genetic manipulation) promotes NSC proliferation while impeding differentiation, ultimately affecting cortical neurogenesis . Extending these findings to pig models could provide valuable insights into evolutionary conservation of these mechanisms and enhance translational potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.