Recombinant Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
RPN2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; Ribophorin II; RPN-II; Ribophorin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-629
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
LKPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLSSLGAQVPDEKKACTFIKSNLDPS NVDSLFYPPQSSQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQ EALGALTARLSKEETVLATVQALQTASYLSQQADLRSIVEEIEDLVARLDELGGVYLQFE EGLLETTALFVAATYKLMDHEGTEPSIKEDQVIQLMNTIFSKKNFESLPEAFSVASAAAA LSQNRYHVPVVVVPEGSPSDTQEQAFLRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQ KTSFTPVGDVFELNFVNVKFSSGYYDFSVKVEGDNRYIANTVELRVKISTEVGITNVDLS TVDKDQSIAPKTTRVTYPAKAKGPFIADSPQNFALFFQLVDVNTGAELTPHQTFVRLHNQ KTGQEVVFVAEPDSKNVYRFELDTSERKIEFDSASGTYTLYLIIGDATLKNPIHWNVADV VIRFPEEDAPSTVLSKNLFTAKQEIQHLFRDPEKRPPTVVSNTFTGLILSPLLLLFALWI RIGAKISNFTFGLTIIFHLGHAMLAMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQ AIKRTAH
Uniprot No.

Target Background

Function

Recombinant Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.

Database Links
Protein Families
SWP1 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity and cellular function of recombinant pig RPN2?

Recombinant Pig RPN2 (Ribophorin II) is an integral rough endoplasmic reticulum (ER) membrane glycoprotein that functions as a critical component of the N-oligosaccharyl transferase complex. This highly conserved protein plays an essential role in protein translocation processes and maintains the structural uniqueness of the rough ER . As part of the glycosylation machinery, RPN2 facilitates the N-linked glycosylation of multiple proteins, a post-translational modification process fundamental to proper protein folding and function . The recombinant form refers to the protein when expressed through genetic engineering techniques rather than isolated directly from native pig tissues.

Biochemically, RPN2 has a calculated molecular weight of 69 kDa and is typically observed at 68-69 kDa in experimental analyses . Its amino acid sequence is encoded by the RPN2 gene (Gene ID: 6185 in humans), and its function is conserved across mammalian species, including pigs, humans, and mice, suggesting evolutionary importance in essential cellular processes.

What detection methods are most reliable for studying recombinant pig RPN2 in laboratory settings?

Multiple validated techniques are available for detecting and studying recombinant pig RPN2, each with specific applications and sensitivity profiles:

ApplicationRecommended DilutionValidated Cell/Tissue TypesSpecial Considerations
Western Blot (WB)1:500-1:1000NIH/3T3 cells68-69 kDa band expected
Immunoprecipitation (IP)0.5-4.0 μg for 1.0-3.0 mg of total protein lysateNIH/3T3 cellsEffective for protein-protein interaction studies
Immunohistochemistry (IHC)1:20-1:200Human lung cancer tissue, human ovary tumor tissueAntigen retrieval with TE buffer pH 9.0 recommended
RNA interference (RNAi)Target-specific designValidated in multiple bladder cancer studiesShown effective in knockdown validation studies

For antibody-based detection, researchers should select reagents with confirmed cross-reactivity to porcine samples . When working with recombinant RPN2, epitope-tagged versions (His, FLAG, etc.) can facilitate detection and purification. For gene expression analysis, quantitative RT-PCR has been successfully employed to measure RPN2 mRNA levels in various research contexts . The selection of method should align with experimental objectives and available sample types.

How does recombinant pig RPN2 expression correlate with specific cellular phenotypes?

RPN2 expression levels have been associated with distinct cellular phenotypes and physiological states in multiple research contexts. Though most extensive studies have been conducted in human and mouse models, the high conservation of RPN2 suggests similar correlations may exist in porcine systems.

In bladder cancer studies, elevated RPN2 expression has been positively correlated with several clinicopathological features:

These correlations suggest that RPN2 may serve as a potential biomarker for disease progression and prognosis . At the cellular level, RPN2 appears to influence proliferation, invasiveness, and therapy resistance through its role in protein glycosylation. The protein-protein interaction network analysis reveals that RPN2 can regulate multiple genes including RPN1, STT3A/B, and MAGT1, which are frequently associated with tumor progression in various cancers .

How does recombinant pig RPN2 modification affect glycosylation patterns relevant to xenotransplantation research?

In xenotransplantation research, controlling the glycosylation patterns of pig tissues is crucial for reducing immunogenic responses when these tissues are transplanted into non-human primates or potentially humans. RPN2, as an integral component of the N-oligosaccharyl transferase complex, plays a significant role in determining these glycosylation patterns.

Current xenotransplantation approaches focus on eliminating specific glycan antigens that trigger rejection. While the search results don't show direct studies specifically targeting RPN2 modification, its function within the glycosylation machinery makes it potentially relevant to these efforts. Genetic engineering strategies currently target several key glycosylation enzymes:

Genetic ModificationFunctionEffect on Xenoantigenicity
GGTA1 knockoutEliminates α-Gal epitope synthesisPrevents binding of preformed xenoreactive antibodies
CMAH knockoutPrevents Neu5Gc synthesisReduces IgM/IgG reactivity and potential cardiac valve calcification
β4GalNT2 knockoutModifies glycan structureFurther reduces human antibody binding
Combined triple knockoutComprehensive glycan modificationPBMCs from these pigs exhibit significantly reduced human IgM and IgG reactivity

The interaction between RPN2 and these targeted glycosylation enzymes represents an important area for further research . Understanding how RPN2 modifications might complement existing approaches could provide new strategies for creating less immunogenic pig organs for transplantation.

What experimental approaches can resolve contradictory data in recombinant pig RPN2 functional studies?

Contradictory results in RPN2 functional studies can arise from variations in experimental design, cell types, or analytical methods. Several advanced approaches can help reconcile these contradictions:

  • Systematic Method Comparison

    • Implement standardized protocols across different experimental systems

    • Perform side-by-side comparisons under identical conditions

    • Document all variables that could influence outcomes

  • Advanced Data Analysis Techniques

    • Gene Set Enrichment Analysis (GSEA) to identify functional pathways associated with RPN2

    • Protein-protein interaction (PPI) network analysis to contextualize RPN2 function in different cellular environments

    • Self-contradiction detection methodologies adapted from document analysis to identify potential sources of experimental inconsistency

  • Multi-modal Experimental Approaches

    • Complement genetic studies with proteomic and glycomic analyses

    • Validate findings across multiple cell lines and primary tissues

    • Develop conditional expression systems to study temporal aspects of RPN2 function

Recent studies examining self-contradictions in complex datasets have demonstrated that even sophisticated models like GPT4 can successfully identify contradictory evidence approximately 70% of the time, while other models perform significantly worse . Adapting these contradiction detection methodologies to experimental biology could provide new frameworks for resolving discrepancies in RPN2 research.

How does differential RPN2 glycosylation affect its functionality in porcine versus human systems?

RPN2 itself is a glycoprotein, and differences in its glycosylation between porcine and human systems may influence its functionality in several ways:

AspectPotential DifferenceResearch Implication
Protein stabilitySpecies-specific glycan patterns may affect half-lifeConsider stability in cross-species studies
Protein-protein interactionsGlycan-mediated interactions may vary between speciesValidate interaction partners in species-specific contexts
Subcellular localizationTrafficking signals might be affected by glycan differencesConfirm localization patterns in porcine cells
Enzymatic activitySubstrate specificity may be influenced by structural differencesCompare enzymatic kinetics between species

While the search results do not provide direct comparative data on porcine versus human RPN2 glycosylation, understanding these potential differences is crucial for translational studies. Researchers working with recombinant pig RPN2 in human cell systems or vice versa should consider these species-specific modifications as potential variables affecting experimental outcomes.

What optimization strategies are essential for successful expression and purification of recombinant pig RPN2?

Successful expression and purification of recombinant pig RPN2 requires careful optimization due to its nature as a membrane-associated glycoprotein. The following strategies are essential:

  • Expression System Selection

    • Mammalian expression systems (CHO, HEK293) generally provide more appropriate post-translational modifications

    • Insect cell systems (Sf9, High Five) offer a compromise between yield and glycosylation complexity

    • Avoid bacterial systems where glycosylation is absent

  • Vector Design Considerations

    • Include appropriate signal sequences for ER targeting

    • Consider epitope tags (His, FLAG) for detection and purification

    • Evaluate the impact of fusion proteins on RPN2 folding and function

  • Purification Strategy

    • Implement a two-stage purification approach:

      • Detergent solubilization (mild detergents like digitonin or DDM)

      • Affinity chromatography using engineered tags or RPN2-specific antibodies

  • Validation Techniques

    • Western blotting using validated antibodies (1:500-1:1000 dilution)

    • Glycosylation analysis to confirm proper post-translational modification

    • Functional reconstitution assays to verify activity in the N-oligosaccharyl transferase complex

The selection of validation methods should be tailored to the specific research question and downstream applications of the recombinant protein.

What gene modification approaches are most effective for studying RPN2 function in porcine models?

Several gene modification approaches have proven effective for studying protein function in porcine models, with specific considerations for RPN2:

ApproachAdvantagesLimitationsRPN2-Specific Considerations
CRISPR-Cas9 KnockoutComplete protein eliminationMay be lethal if RPN2 is essentialConsider conditional knockout strategies
RNAi KnockdownTunable reduction in expressionIncomplete silencingVerify knockdown at both mRNA and protein levels
Base EditingPrecise mutation without DSBsLimited to certain mutation typesTarget conserved functional domains
Knock-in StrategiesTag endogenous proteinMay affect protein functionConsider tag position to minimize functional impact

When designing gene modification strategies for RPN2, researchers should:

  • Target highly conserved regions of the gene for maximum effect

  • Include appropriate controls, including rescue experiments with wild-type RPN2

  • Validate modifications at genomic, transcriptomic, and proteomic levels

  • Consider potential compensatory mechanisms involving related proteins like RPN1

Published knockout/knockdown studies have demonstrated the utility of these approaches in investigating RPN2 function, with one study showing that RPN2 knockdown in bladder cancer models reduced cancer cell proliferation and invasion .

What analytical techniques best characterize RPN2-associated protein complexes in porcine systems?

Characterizing RPN2-associated protein complexes requires techniques that preserve native interactions while providing detailed compositional information:

  • Co-Immunoprecipitation (Co-IP)

    • Use 0.5-4.0 μg antibody for 1.0-3.0 mg of total protein lysate

    • Employ mild lysis conditions to preserve protein-protein interactions

    • Validate with reciprocal Co-IP using antibodies against putative interaction partners

  • Proximity Labeling Methods

    • BioID or TurboID fusion with RPN2 to identify proteins in close proximity

    • APEX2-based approaches for temporal resolution of interaction dynamics

    • Mass spectrometry analysis of biotinylated proteins

  • Native Gel Electrophoresis

    • Blue Native PAGE to maintain complex integrity

    • Clear Native PAGE for antibody-based detection

    • Second-dimension SDS-PAGE for subunit composition analysis

  • Quantitative Interaction Proteomics

    • SILAC or TMT labeling for comparative interaction studies

    • Label-free quantification for broader experimental flexibility

    • Statistical analysis of interaction significance using tools like SAINT or CompPASS

These approaches can be complemented by computational methods such as protein-protein interaction network analysis using tools like STRING, which has previously identified connections between RPN2 and proteins like RPN1, STT3A/B, and MAGT1 .

How should researchers analyze contradictory data in RPN2 expression studies?

Analyzing contradictory data in RPN2 expression studies requires robust methodological approaches and careful consideration of potential confounding factors:

  • Meta-analytical Frameworks

    • Implement systematic review methodologies with predefined inclusion criteria

    • Employ random-effects models to account for heterogeneity across studies

    • Use forest plots to visualize effect sizes and confidence intervals across studies

  • Statistical Approaches for Contradictory Data

    • Apply Bayesian methods to incorporate prior knowledge and uncertainty

    • Conduct sensitivity analyses to identify influential data points or methodological factors

    • Implement multivariate analyses to account for covariates and interaction effects

  • Contradiction Resolution Strategies

    • Identify potential biological mechanisms that could explain divergent results

    • Stratify analyses by cell type, experimental condition, or disease state

    • Develop computational models to test hypothesized explanations for contradictions

Research on document self-contradiction detection has shown that even advanced models can struggle with identifying contradictions consistently, with GPT4 achieving approximately 70% accuracy while other models perform significantly worse . These findings highlight the importance of rigorous approaches to identifying and resolving contradictions in complex biological datasets.

The table below summarizes performance metrics for self-contradiction detection that could be adapted for analyzing contradictory RPN2 data:

ModelBinary Task PerformanceEvidence Identification Success RateAverage Evidence Position
GPT4Moderate accuracy~70%1.79 out of 5
GPT3.5Near-random performance~43%Higher position (less optimal)
PaLM2Near-random performance~48%Higher position (less optimal)
LLaMAv2Biased toward "yes" predictions~20%Highest position (least optimal)

What statistical methods best analyze RPN2 expression in heterogeneous tissue samples?

Analyzing RPN2 expression in heterogeneous tissue samples presents unique statistical challenges requiring specialized approaches:

  • Deconvolution Methods

    • Reference-based deconvolution using known cell-type signatures

    • Reference-free methods like non-negative matrix factorization

    • CIBERSORTx or similar tools for estimating cellular composition from bulk expression data

  • Hierarchical and Mixed-Effects Models

    • Account for nested data structures (tissues within subjects)

    • Include random effects for subject-specific variation

    • Allow for covariate adjustment while handling correlation

  • Multiple Testing Correction Strategies

    • Benjamini-Hochberg procedure for controlling false discovery rate

    • Bonferroni correction for family-wise error rate

    • False Discovery Rate (FDR) q-values for genomic-scale analyses

In bladder cancer studies, statistical approaches including Chi-square tests for categorical comparisons, paired Student's t-tests for continuous variables between groups, and one-way ANOVA for multi-group comparisons have been successfully employed . For survival analyses, the Kaplan-Meier method with Log rank testing has demonstrated utility in evaluating the relationship between RPN2 expression and clinical outcomes .

How does recombinant pig RPN2 research contribute to xenotransplantation advancements?

Recombinant pig RPN2 research has important implications for xenotransplantation advancement through its role in the glycosylation machinery:

  • Glycan-Based Rejection Mechanisms

    • RPN2's function in the N-oligosaccharyl transferase complex affects glycan patterns

    • Human antibody recognition of pig-specific glycans drives xenograft rejection

    • Modification of RPN2 or associated proteins could alter immunogenic glycan profiles

  • Integration with Established Genetic Modifications

    • Current approaches focus on eliminating specific xenoantigens:

      • GGTA1 knockout eliminates α-Gal epitope

      • CMAH knockout prevents Neu5Gc synthesis

      • β4GalNT2 knockout modifies glycan structures

    • RPN2 modification could complement these approaches by altering N-glycosylation patterns

  • Tissue-Specific Considerations

    • Differential RPN2 expression across tissues may influence organ-specific rejection responses

    • Cardiac tissues show particular sensitivity to certain glycan-mediated rejection mechanisms

    • RPN2 modification effects may vary between solid organs and cellular transplants

Studies have shown that peripheral blood mononuclear cells (PBMCs) from pigs with multiple glycosylation enzyme knockouts (GGTA1/CMAH/β4GalNT2) exhibit significantly reduced human IgM and IgG reactivity compared to cells lacking fewer modifications . Understanding how RPN2 interacts with these pathways could provide additional targets for reducing xenograft immunogenicity.

What are the implications of RPN2 expression patterns for developing porcine disease models?

RPN2 expression patterns have significant implications for developing porcine disease models, particularly in cancer and glycosylation-related disorders:

  • Cancer Modeling Applications

    • RPN2 overexpression correlates with poor prognosis in human cancers

    • Modulating RPN2 expression in pigs could create models that recapitulate human disease progression

    • The correlation between RPN2 and clinical features provides validation targets:

  • Glycosylation Disorder Models

    • As part of the N-glycosylation machinery, RPN2 is relevant to congenital disorders of glycosylation

    • Genetic modification of RPN2 could create models for studying these rare human diseases

    • Partial knockdown might mimic hypomorphic mutations seen in human patients

  • Immune Response Research

    • Altered glycosylation affects immune recognition and regulation

    • RPN2-modified pigs could provide insights into glycan-mediated immune processes

    • Particularly relevant for studying autoimmune and inflammatory conditions

Gene Set Enrichment Analysis (GSEA) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analyses have proven useful for exploring the roles of RPN2 in biological behaviors, particularly in cancer contexts . These approaches could be similarly applied to characterize porcine disease models with altered RPN2 expression.

What emerging technologies will advance recombinant pig RPN2 research in the next decade?

Several cutting-edge technologies are positioned to significantly advance recombinant pig RPN2 research:

  • Single-Cell Multi-omics Integration

    • Single-cell RNA sequencing combined with glycoproteomics

    • Spatial transcriptomics to map RPN2 expression in tissue context

    • Multi-modal data integration to correlate RPN2 with glycosylation patterns

  • Advanced Genome Editing Technologies

    • Base editing for precise modification without double-strand breaks

    • Prime editing for flexible sequence alterations

    • Epigenome editing to modulate RPN2 expression without sequence changes

  • Structural Biology Innovations

    • Cryo-electron microscopy of RPN2 in native membrane complexes

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • AlphaFold and related AI approaches for structural prediction and interaction modeling

  • Systems Glycobiology Frameworks

    • Comprehensive glycan profiling in modified pig models

    • Glycan-focused bioinformatics tools for pattern recognition

    • Integrated glycomics, proteomics, and transcriptomics analyses

  • Contradiction Resolution Technologies

    • Automated contradiction detection methodologies derived from document analysis research

    • Machine learning approaches to identify patterns in seemingly contradictory results

    • Standardized reporting frameworks to facilitate cross-study comparison

The application of these technologies to recombinant pig RPN2 research will likely yield more comprehensive understanding of its function and therapeutic potential in coming years.

How might recombinant RPN2 research contribute to solving persistent challenges in xenotransplantation?

Recombinant RPN2 research holds potential to address several persistent challenges in xenotransplantation:

  • Beyond Current Genetic Modifications

    • Current approaches focus on eliminating specific xenoantigens (GGTA1, CMAH, β4GalNT2)

    • RPN2 modification could alter broader patterns of N-glycosylation

    • Combined approaches might address residual xenoantigenicity after current modifications

  • Addressing Late Rejection Phenomena

    • While current modifications prevent hyperacute rejection, delayed rejection remains problematic

    • RPN2's role in protein glycosylation may influence ongoing immune recognition

    • Studies of long-term xenograft survival could benefit from RPN2-focused interventions

  • Tissue-Specific Solutions

    • Differential glycosylation requirements across organs suggest need for tissue-specific approaches

    • RPN2 expression and function may vary between tissues

    • Cardiac valve xenotransplantation particularly affected by certain glycan modifications

  • Methodological Advances

    • Development of standardized assays for xenoantigenicity assessment

    • Improved detection of anti-pig antibodies in recipient serum

    • Advanced imaging techniques for monitoring xenograft rejection

By integrating RPN2 research with existing xenotransplantation approaches, researchers may develop more comprehensive solutions to the complex immunological barriers that currently limit clinical xenotransplantation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.