Recombinant Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Introduction to DAD1

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, commonly abbreviated as DAD1, was initially identified as a negative regulator of programmed cell death in temperature-sensitive cell lines. The protein earned its name "defender against apoptotic cell death" after researchers observed that its disappearance in temperature-sensitive cells following a shift to nonpermissive temperatures triggered apoptosis, suggesting a crucial role in cell survival . Beyond its anti-apoptotic function, DAD1 has been recognized as a tightly associated subunit of oligosaccharyltransferase (OST), reflecting the essential nature of N-linked glycosylation in eukaryotes .

In pig models, the DAD1 protein has attracted considerable research interest due to its high degree of conservation across species and its fundamental role in cellular processes. Recombinant production of pig DAD1 has enabled detailed investigation of its structure and function, providing valuable insights into its biochemical properties and potential applications in various research contexts.

Physical and Chemical Properties

Table 1 summarizes the key physical and chemical properties of pig DAD1 protein.

PropertyCharacteristic
Molecular Weight12 kDa (theoretical), 16-20 kDa (observed on SDS-PAGE)
Protein TypeMembrane protein, multi-pass
Cellular LocalizationEndoplasmic reticulum membrane
Oligomerization StatePart of oligosaccharyltransferase complex
Enzyme ClassificationEC 2.4.1.119
Protein StabilityTemperature-sensitive in certain cell lines
StructureContains multiple transmembrane domains

The protein exhibits notable stability characteristics, with proper folding crucial for its function. When recombinantly produced with tags such as His-tag, care must be taken to ensure that the tag does not interfere with the functional domains of the protein .

Role in N-linked Glycosylation

DAD1 serves as an essential component of the N-oligosaccharyl transferase enzyme complex, which catalyzes a critical step in N-linked protein glycosylation. This enzyme transfers high-mannose oligosaccharides from dolichyl-diphosphooligosaccharide donors to asparagine residues within the consensus motif Asn-X-Ser/Thr in nascent polypeptide chains .

The glycosylation process occurs cotranslationally as proteins are synthesized and transported across the endoplasmic reticulum membrane. The OST complex, including DAD1, associates with the Sec61 complex at the channel-forming translocon to facilitate this process . This modification is essential for proper protein folding, trafficking, and function.

Anti-apoptotic Function

Beyond its role in glycosylation, DAD1 has been established as a negative regulator of programmed cell death. Loss of the DAD1 protein has been directly linked to the triggering of apoptotic pathways, indicating its crucial role in maintaining cell viability . The specific mechanisms through which DAD1 prevents apoptosis are still being elucidated, but research suggests connections to cellular stress response pathways.

Protein Interactions

DAD1 has been shown to interact with various proteins, most notably as part of the OST complex. In human studies, DAD1 has demonstrated interaction with MCL1 (Myeloid Cell Leukemia 1), an anti-apoptotic protein of the Bcl-2 family . These interactions further underscore DAD1's role in regulating programmed cell death and suggest potential involvement in broader cellular signaling networks.

Expression Systems and Methods

Recombinant pig DAD1 can be produced using various expression systems, with E. coli being the most commonly utilized host for heterologous expression. The protein is typically expressed with fusion tags to facilitate purification and detection, with His-tags being particularly common . Cell-free expression systems have also been employed for pig DAD1 production, offering advantages for membrane protein expression .

Table 2 summarizes common expression systems for recombinant pig DAD1 production.

Expression SystemAdvantagesChallengesCommon Tags
E. coliHigh yield, cost-effective, rapid productionPotential for improper folding of membrane proteinsHis, GST
YeastPost-translational modifications, proper foldingLower yield than bacterial systemsHis, FLAG
BaculovirusHigher eukaryotic processing, complex proteinsMore complex system, higher costHis, FLAG, HA
Mammalian CellNative-like processing and foldingHighest cost, lower yieldHis, FLAG, HA
Cell-Free ExpressionMembrane protein-friendly, rapidHigher cost, optimization requiredHis, Biotin

Purification and Quality Control

Following expression, recombinant pig DAD1 typically undergoes affinity chromatography for purification, with the specific method dependent on the fusion tag employed. For His-tagged DAD1, immobilized metal affinity chromatography (IMAC) is the standard approach . After purification, the protein is often formulated in Tris-based buffers with glycerol to maintain stability during storage.

Quality control assessments include SDS-PAGE analysis to verify purity (typically ≥85-90%), mass spectrometry to confirm identity, and functional assays to verify bioactivity . For recombinant pig DAD1 intended for research applications, endotoxin testing may also be performed to ensure suitability for cell culture experiments.

ELISA Systems for DAD1 Detection

Enzyme-linked immunosorbent assay (ELISA) kits for pig DAD1 represent important tools for quantitative analysis in research settings. These assays typically employ a sandwich ELISA format, with antibodies specific for DAD1 pre-coated onto microplates. After sample addition and binding of target DAD1, a biotin-conjugated detection antibody is applied, followed by streptavidin-HRP and substrate development to enable colorimetric quantification .

The sensitivity and specificity of these assays make them valuable for measuring DAD1 levels in various sample types, including serum, plasma, and tissue lysates. Typical detection ranges are in the picogram to nanogram per milliliter range, with intra- and inter-assay coefficients of variation generally below 10% .

Glycobiology Research

Recombinant pig DAD1 has proven invaluable for studies of N-linked glycosylation, a fundamental process in cellular biology. Researchers have utilized this protein to investigate the specific mechanisms of the OST complex and to explore how glycosylation patterns influence protein folding, trafficking, and function . Such studies provide insights not only into normal cellular processes but also into pathological conditions associated with glycosylation defects.

Apoptosis and Cell Death Pathways

Given DAD1's established role as an anti-apoptotic factor, recombinant pig DAD1 has facilitated detailed investigation of programmed cell death mechanisms. Studies employing this protein have explored how loss of DAD1 function triggers apoptotic cascades and have examined potential connections to other cellular stress response pathways . These investigations contribute to our broader understanding of cell survival mechanisms and may inform approaches to modulating cell death in various disease contexts.

Biomarker Development

Some research has explored the potential utility of DAD1 as a biomarker for specific conditions. While human studies have suggested associations between DAD1 gene polymorphisms and neuroendocrine tumors , parallel investigations in pig models may provide valuable comparative insights. Recombinant pig DAD1 serves as an important reference standard for such biomarker development efforts.

Immunological Detection Methods

Antibodies against pig DAD1 enable various detection approaches, including Western blotting, immunohistochemistry, immunofluorescence, and immunoprecipitation. These methods allow researchers to visualize and quantify DAD1 expression in different tissues and cellular compartments . Such analyses have revealed that DAD1 is primarily localized to the endoplasmic reticulum membrane, consistent with its role in the OST complex.

Immunohistochemistry protocols typically involve paraformaldehyde fixation, paraffin embedding, and antigen retrieval using sodium citrate buffer (pH 6.0). DAD1 antibodies are generally applied at dilutions of 1:50 to 1:500, with visualization achieved through standard secondary antibody systems .

Functional Assays

Functional characterization of recombinant pig DAD1 often employs assays measuring glycosyltransferase activity or anti-apoptotic effects. Glycosyltransferase assays typically assess the transfer of oligosaccharides to suitable peptide acceptors, while apoptosis assays may examine the protein's ability to prevent programmed cell death in susceptible cell lines .

These functional analyses are crucial for confirming that recombinantly produced DAD1 retains its native biological activities and for investigating how structural modifications or mutations might alter these functions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-113
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
SASVLSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Uniprot No.

Target Background

Function
Recombinant Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation, a cotranslational process. The OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER) membrane. All subunits are essential for optimal enzymatic activity.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 and what are its primary functions?

Pig DAD1 (Defender Against Apoptotic cell Death 1) is a critical subunit of the oligosaccharyltransferase (OST) complex that catalyzes the transfer of high-mannose oligosaccharides to asparagine residues within the Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This represents the initial and essential step in protein N-glycosylation . The protein serves a dual function: it is tightly integrated into the OST complex for glycosylation activities while simultaneously functioning as a negative regulator of programmed cell death. The loss of DAD1 protein has been demonstrated to trigger apoptosis, highlighting its crucial role in cell survival mechanisms .

How is Pig DAD1 structurally organized at the cellular level?

Pig DAD1 is a small but essential membrane protein primarily localized in the endoplasmic reticulum (ER) membrane. It has a molecular weight of approximately 12.5 kDa and consists of 113 amino acids in its full-length form . The protein adopts a multi-pass transmembrane configuration, with regions embedded within the ER membrane and other domains extending into the ER lumen. This structural arrangement is crucial for its participation in the oligosaccharyltransferase complex, which operates at the interface of protein translation and translocation across the ER membrane. DAD1 associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the ER .

How does Pig DAD1 integrate into the oligosaccharyltransferase complex and what are its specific interactions?

Pig DAD1 functions as a non-catalytic but essential subunit of the oligosaccharyltransferase (OST) complex. Research has revealed that DAD1 is required for the assembly of both SST3A- and SS3B-containing OST complexes . The integration of DAD1 occurs during the formation of the OST complex and remains tightly associated both in the intact membrane environment and in the purified enzyme preparation.

Within the complex, DAD1 interacts with several other subunits, providing structural stability rather than direct catalytic activity. The OST complex co-purifies with ribosomes, indicating its crucial role in cotranslational modification of nascent proteins . The loss of DAD1 destabilizes the entire OST complex, rendering it non-functional, which explains why DAD1 deficiency leads to severe defects in N-glycosylation across the cellular proteome.

What are the molecular mechanisms by which DAD1 regulates apoptosis?

DAD1 was initially identified as a negative regulator of programmed cell death in temperature-sensitive tsBN7 cells. The molecular mechanisms of DAD1-mediated apoptosis regulation appear to be linked to its essential role in N-glycosylation processes. Current research suggests several pathways:

  • ER Stress Pathway: Disruption of N-glycosylation due to DAD1 deficiency leads to accumulation of misfolded proteins, triggering ER stress and the unfolded protein response (UPR), which can activate apoptotic pathways if prolonged.

  • Direct Signaling: Some evidence suggests DAD1 may directly interact with apoptotic machinery independent of its glycosylation role.

  • Cell Surface Receptor Modulation: N-glycosylation affects the folding, stability, and function of numerous cell surface receptors involved in survival signaling. DAD1 deficiency may impair these proteins' functionality.

The relationship between DAD1 disappearance and apoptosis activation has been clearly demonstrated when temperature-sensitive cells are shifted to non-permissive temperatures, suggesting a direct link between DAD1 levels and cell survival mechanisms .

What post-translational modifications occur in Pig DAD1 and how do they affect its function?

While specific data on post-translational modifications (PTMs) of pig DAD1 is limited in the provided search results, research on mammalian DAD1 orthologs provides insights applicable to the porcine variant. Key modifications likely include:

Modification TypePositionFunctional Impact
PhosphorylationSer/Thr residuesRegulation of protein-protein interactions and complex stability
UbiquitinationLys residuesRegulation of protein turnover and degradation
GlycosylationN/ADAD1 itself is likely not glycosylated despite mediating glycosylation
AcetylationN-terminalPotential role in protein stability and localization

These PTMs may regulate DAD1's half-life, interaction with other OST components, and response to cellular stress conditions. Further research using phosphoproteomic and other PTM-specific analytical approaches would be valuable to fully characterize these modifications in pig DAD1 .

What are optimal techniques for recombinant expression and purification of Pig DAD1?

For successful recombinant expression and purification of Pig DAD1, the following methodological approach is recommended:

  • Expression System Selection: For membrane proteins like DAD1, eukaryotic expression systems such as Pichia pastoris or Yarrowia lipolytica often yield better results than bacterial systems. These yeast systems provide appropriate post-translational modifications and membrane insertion machinery .

  • Vector Design: Construct expression vectors containing the pig DAD1 coding sequence (CDS) with appropriate purification tags (His-tag, FLAG-tag, etc.) positioned to avoid interference with membrane insertion. Consider using inducible promoters to control expression levels.

  • Optimization Parameters:

    • Temperature: 25-30°C often balances expression and proper folding

    • Induction time: 16-24 hours typically yields optimal protein accumulation

    • Medium composition: Supplement with glycerol for yeast systems

  • Membrane Protein Solubilization: Use mild detergents such as n-Dodecyl β-D-maltoside (DDM) or digitonin to solubilize DAD1 while maintaining its native conformation and associations.

  • Purification Strategy: Employ a multi-step approach including:

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography to isolate properly folded monomeric or complexed DAD1

    • Ion exchange chromatography for final polishing

Throughout the process, maintain reducing conditions and include protease inhibitors to prevent degradation of this small membrane protein .

How can researchers effectively validate DAD1 antibodies for experimental applications?

Validating antibodies against Pig DAD1 requires a systematic approach to ensure specificity, sensitivity, and reproducibility in various experimental contexts:

  • Positive and Negative Controls:

    • Use recombinant pig DAD1 protein as a positive control

    • Include DAD1-knockout or knockdown samples as negative controls

    • Compare with tissues/cells known to express varying levels of DAD1

  • Cross-Reactivity Assessment:

    • Test antibodies against recombinant human DAD1 to evaluate species cross-reactivity

    • Confirm specificity using Western blot to detect a single band at ~12.5 kDa

    • Perform immunoprecipitation followed by mass spectrometry to confirm target identity

  • Application-Specific Validation:

    • For immunohistochemistry: Use paraformaldehyde-fixed, paraffin-embedded tissues with appropriate antigen retrieval methods. Validated protocols include boiling in sodium citrate buffer (pH 6.0) for 15 minutes, followed by blocking with normal goat serum .

    • For immunofluorescence: Evaluate subcellular localization patterns, ensuring ER membrane colocalization

    • For ELISA: Generate standard curves using recombinant DAD1 to determine detection limits

  • Antibody Characterization Documentation:

    • Record antibody performance across different lots

    • Document optimal working dilutions (e.g., 1:200 for IHC as reported)

    • Validate in multiple cell/tissue types relevant to your research

This comprehensive validation approach ensures reliable results in downstream experimental applications .

What are the most effective methods for analyzing DAD1 functionality in glycosylation processes?

To effectively analyze DAD1 functionality in glycosylation processes, researchers should employ a multi-faceted approach:

  • Cell-Based Glycosylation Assays:

    • Utilize temperature-sensitive DAD1 mutant cell lines (similar to tsBN7) to controllably manipulate DAD1 function

    • Employ CRISPR/Cas9 for generating conditional DAD1 knockout cells

    • Assess glycosylation changes using lectins with different specificities to detect alterations in glycan profiles

  • Biochemical Analysis of N-Glycosylation:

    • Monitor the transfer of high-mannose oligosaccharides to reporter proteins containing the Asn-X-Ser/Thr consensus motif

    • Employ glycoproteomics to quantitatively assess changes in site-specific glycosylation occupancy across the proteome

    • Use PNGase F treatment followed by electrophoretic mobility shift assays to measure gross changes in N-glycosylation

  • OST Complex Activity Measurements:

    • Reconstitute OST activity in vitro using microsomal preparations

    • Measure transfer of radioactively labeled oligosaccharides from dolichol donors to acceptor peptides

    • Analyze the integrity of the OST complex using blue native PAGE or co-immunoprecipitation with antibodies against other OST subunits

  • Structural Studies:

    • Employ crosslinking mass spectrometry to map interaction interfaces between DAD1 and other OST components

    • Use cryo-EM to visualize the intact OST complex with and without functional DAD1

What are the optimal conditions for using Pig DAD1 ELISA kits in research applications?

For optimal performance when using Pig DAD1 ELISA kits in research applications, the following methodological considerations should be implemented:

  • Sample Preparation:

    • For tissue samples: Homogenize in appropriate extraction buffer containing protease inhibitors

    • For cell culture: Collect cells and lyse with buffer optimized for membrane protein extraction

    • Centrifuge samples at high speed (≥10,000g) to remove debris

    • Determine total protein concentration using BCA or Bradford assay for normalization

  • Assay Execution:

    • Follow the sandwich ELISA format where DAD1-specific antibodies are pre-coated onto microplates

    • Add samples and standards in duplicates or triplicates

    • Use biotin-conjugated secondary antibodies followed by streptavidin-HRP for detection

    • Employ substrate solution that develops color proportional to DAD1 concentration

    • Stop the reaction at a consistent timepoint and measure absorbance immediately

  • Quality Control Measures:

    • Include standard curves ranging from 0 to known maximum physiological concentrations

    • Add positive controls (recombinant pig DAD1) and negative controls

    • Establish intra-assay CV (%) and inter-assay CV(%) to ensure reproducibility

    • Validate kit performance with Western blot confirmation of selected samples

  • Data Analysis Considerations:

    • Use appropriate curve-fitting models (typically 4PL or 5PL)

    • Account for dilution factors in final concentration calculations

    • Normalize results to total protein content when comparing different sample types

The detection range and sensitivity will depend on the specific kit, but most commercial assays for pig DAD1 enable detection within the physiological range of expression in various tissues .

How can researchers effectively analyze the dual role of DAD1 in glycosylation and apoptosis regulation?

To effectively analyze the dual functionality of DAD1 in both glycosylation and apoptosis regulation, researchers should employ experimental designs that can distinguish between these potentially interlinked roles:

  • Separation of Functions through Targeted Mutations:

    • Generate point mutations in DAD1 that differentially affect its glycosylation function versus potential direct apoptosis regulation

    • Develop chimeric proteins that preserve structural requirements for OST complex integration but alter putative apoptosis-regulatory domains

    • Use complementation studies in DAD1-deficient cells to assess which functions are rescued by different mutant variants

  • Temporal Analysis of Functional Consequences:

    • Establish time-course experiments using inducible DAD1 knockdown systems

    • Monitor glycosylation defects and apoptotic markers sequentially to establish causality

    • Employ live-cell imaging with appropriate biosensors to track both processes in real-time

  • Pathway Dissection Approaches:

    • Inhibit specific branches of apoptotic pathways to identify which are activated upon DAD1 loss

    • Employ chemical chaperones to mitigate ER stress caused by glycosylation defects

    • Use glycosylation inhibitors to compare with DAD1 depletion phenotypes

  • System-Level Analysis:

    • Perform transcriptomic and proteomic analyses at different time points after DAD1 perturbation

    • Apply pathway enrichment analysis to identify whether apoptotic activation precedes or follows glycosylation defects

    • Use mathematical modeling to understand the kinetic relationship between these processes

This integrated approach can help distinguish between direct apoptosis regulation by DAD1 and indirect effects stemming from its role in N-glycosylation .

What are the key experimental controls required for DAD1 knockdown studies?

For rigorous DAD1 knockdown studies, the following essential controls should be implemented:

Documentation of these controls is essential for publication and reproducibility of DAD1 functional studies. Researchers should aim to report all control results, even when no significant differences are observed .

How can contradictory results in DAD1 functional studies be reconciled and interpreted?

Contradictory results in DAD1 functional studies may arise from numerous factors. Here's a systematic approach to reconcile and interpret such discrepancies:

  • Methodological Differences Analysis:

    • Compare experimental models (cell lines, primary cells, tissues, in vivo systems)

    • Assess differences in DAD1 perturbation approaches (knockout vs. knockdown, acute vs. chronic)

    • Evaluate assay sensitivity and specificity across studies

    • Examine the timing of measurements relative to DAD1 depletion

  • Biological Context Evaluation:

    • Consider cell type-specific dependencies on N-glycosylation

    • Assess baseline stress levels and adaptive responses in different systems

    • Examine compensatory mechanisms that may emerge in chronic vs. acute models

    • Evaluate the influence of culture conditions or animal housing variables

  • Data Integration Approaches:

    • Perform meta-analysis of available data with appropriate statistical methods

    • Develop testable hypotheses that could explain apparent contradictions

    • Design experiment series that systematically vary conditions to identify critical parameters

    • Use mathematical modeling to determine whether contradictions might reflect different aspects of a more complex system behavior

  • Resolution Strategies:

    • Direct comparative studies under identical conditions

    • Collaboration between labs reporting conflicting results

    • Development of consensus protocols for DAD1 functional assessment

    • Investigation of potential strain-specific or genetic background effects

When interpreting seemingly contradictory data, consider that DAD1's dual role in glycosylation and apoptosis regulation may manifest differently depending on cellular context, and that temporal dynamics of these processes may lead to apparently conflicting observations when measured at different time points .

How can pig DAD1 research contribute to understanding human glycosylation disorders?

Pig DAD1 research offers valuable insights into human glycosylation disorders due to several key factors:

  • Evolutionary Conservation and Translational Relevance:

    • The high sequence homology between pig and human DAD1 (>90% identity) enables direct translational applications

    • Conserved functional domains suggest shared mechanisms in N-glycosylation pathways

    • Similar tissue expression patterns facilitate comparative pathology studies

  • Modeling Congenital Disorders of Glycosylation (CDGs):

    • Porcine models with DAD1 mutations can recapitulate human CDG phenotypes

    • The pig's similar physiology to humans makes it ideal for studying systemic effects of glycosylation defects

    • Larger size compared to rodents facilitates sample collection and intervention testing

  • Specific Research Applications:

    • Investigation of tissue-specific glycosylation requirements that may explain variable phenotypes in human patients

    • Development of targeted therapies to modulate N-glycosylation in disease contexts

    • Identification of biomarkers for early detection and monitoring of glycosylation disorders

  • Examples of Direct Applications:

    • DDOST-CDG (Congenital Disorder of Glycosylation, Type 1r) involves OST complex dysfunction

    • Insights from pig models may help explain phenotypic variability in patients with similar genetic defects

    • Testing of chaperone therapies to stabilize mutant OST components

Pig models offer significant advantages over rodent systems due to their more human-like physiology, longer lifespan, and similar metabolic parameters, making them particularly valuable for understanding the complex systemic effects of glycosylation disorders in humans .

What emerging technologies show promise for advancing DAD1 research?

Several cutting-edge technologies are poised to significantly advance our understanding of DAD1 biology and function:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy has revolutionized membrane protein structural studies and could reveal DAD1's precise position and interactions within the OST complex

    • Integrative structural biology combining XL-MS (crosslinking mass spectrometry), HDX-MS (hydrogen-deuterium exchange), and computational modeling to map dynamic interactions

    • Single-particle analysis to capture conformational states during the catalytic cycle

  • Genome Editing and Cellular Engineering:

    • CRISPR-Cas9 base editing for creating precise point mutations mimicking human pathogenic variants

    • Inducible degradation systems (e.g., AID, dTAG) for temporal control of DAD1 levels

    • Cell-specific conditional knockout swine models using tissue-specific promoters and Cre-lox technology

  • Advanced 'Omics Approaches:

    • Spatial glycoproteomics to map tissue-specific impacts of DAD1 dysfunction

    • Single-cell multi-omics to understand cellular heterogeneity in response to DAD1 perturbation

    • Glycan imaging using metabolic labeling and click chemistry for real-time visualization of glycosylation processes

  • Translational Research Tools:

    • Organ-on-chip technologies incorporating primary cells from DAD1-modified swine

    • Patient-derived iPSCs differentiated into affected cell types to study human-specific aspects

    • High-throughput screening platforms to identify modulators of DAD1 function or compounds that can bypass glycosylation defects

These technologies, particularly when used in combination, have the potential to address longstanding questions about DAD1's precise molecular functions and could lead to therapeutic approaches for glycosylation disorders .

How does DAD1 research intersect with cancer biology and potential therapeutic applications?

The intersection between DAD1 research and cancer biology presents significant opportunities for both mechanistic understanding and therapeutic development:

  • DAD1 Expression in Cancer:

    • Altered DAD1 expression has been observed in various cancer types

    • Single-nucleotide polymorphisms in the DAD1 gene have been associated with neuroendocrine tumors

    • Changes in N-glycosylation patterns are a hallmark of malignant transformation

  • Mechanistic Connections:

    • Apoptosis evasion is a hallmark of cancer, and DAD1's role as a negative regulator of cell death makes it a potential contributor to this phenotype

    • Altered glycosylation affects receptor tyrosine kinase signaling, cell adhesion, and immune recognition

    • DAD1-dependent glycosylation may influence cancer stem cell properties and metastatic potential

  • Therapeutic Implications:

    • DAD1 could represent a novel target for cancer therapy, particularly in cancers showing DAD1 upregulation

    • Modulating specific glycosylation events downstream of DAD1 activity may restore normal cell behavior

    • Combination approaches targeting both glycosylation and apoptotic pathways may overcome resistance mechanisms

  • Research Strategies:

    • Correlative studies between DAD1 expression/mutation and patient outcomes

    • Functional studies manipulating DAD1 levels in cancer models to assess effects on tumor growth, metastasis, and treatment response

    • Development of tools to specifically target cancer-associated glycosylation changes

This research area highlights the importance of understanding basic biological processes like N-glycosylation in the context of complex diseases, and how fundamental research on proteins like DAD1 can lead to unexpected clinical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.