Recombinant Pig Enteropeptidase (TMPRSS15)

What is enteropeptidase (TMPRSS15) and what is its physiological role?

Enteropeptidase, also known as TMPRSS15 (Transmembrane Protease Serine 15), is a type II transmembrane serine protease primarily expressed in the duodenum. It plays a critical role in protein digestion by activating trypsinogen to trypsin, thereby initiating the digestive enzyme cascade in the small intestine . This activation is essential for proper nutrient absorption and maintaining gut health. Functionally, TMPRSS15 cleaves the specific sequence (Asp)4-Lys found in trypsinogen, demonstrating high substrate specificity that is crucial for its biological activity.

The protein contains several distinct domains: a transmembrane domain (TM), a SEA (sea urchin sperm protein, enterokinase, agrin) domain, an LDLR (LDL receptor-like) domain, a C1r/s (complement component C1r-like) domain, a MAM (meprin-like) domain, and a MSCR (macrophage scavenger receptor-like) domain . This complex domain structure contributes to its specific localization and function within the intestinal epithelia.

What are the primary applications of recombinant pig enteropeptidase in research?

Recombinant pig enteropeptidase serves multiple research applications in biochemistry, molecular biology, and structural biology fields. The primary applications include:

• Protein expression system development - Recombinant TMPRSS15 is frequently used to cleave fusion proteins containing the (Asp)4-Lys recognition sequence, allowing for the production of proteins with native N-termini in expression systems.

• Digestive physiology studies - The enzyme enables investigations into digestive enzyme activation cascades and protein digestion mechanisms.

• Structure-function relationship studies - Recombinant TMPRSS15 facilitates analysis of the structural determinants of protease specificity and catalytic efficiency.

• Comparative biochemistry - The pig variant allows researchers to compare species-specific differences in enzymatic properties with human and other mammalian counterparts .

• Protein engineering - The enzyme can be used in the development of novel protein purification technologies based on specific proteolytic cleavage.

How should recombinant pig enteropeptidase be stored and handled for optimal stability?

For optimal stability and retention of enzymatic activity, recombinant pig enteropeptidase should be handled according to specific storage and reconstitution protocols:

• Storage: Store the lyophilized powder at -20°C to -80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles which can significantly reduce enzymatic activity .

• Reconstitution: Prior to opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water or 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL .

• Post-reconstitution: For long-term storage, add glycerol to a final concentration of 5-50% (commonly 50%) and store in aliquots at -80°C. The reconstituted protein solution can be stored at 4°C for up to one week, but longer-term storage requires temperatures below -80°C .

• Working buffer: The optimal buffer system for maintaining enzymatic activity typically contains divalent cations (particularly calcium), which are essential cofactors for many serine proteases.

• Avoid repeated freeze-thaw cycles as they significantly degrade enzymatic activity. Working aliquots can be stored at 4°C for up to one week .

What expression systems are most effective for recombinant pig enteropeptidase production?

E. coli Expression System:

• Advantages: High yield, cost-effectiveness, well-established protocols, and simpler purification processes.

• Limitations: Potential issues with protein folding, lack of post-translational modifications, and possible formation of inclusion bodies requiring refolding steps.

• Application: Most commercially available recombinant pig TMPRSS15 products are expressed in E. coli, particularly for applications where glycosylation is not critical .

When designing an expression strategy for TMPRSS15, researchers should consider:

• The specific domain or fragment to be expressed (full-length vs. catalytic domain)

• The addition of fusion tags (His-tag is commonly used for purification)

• Codon optimization for the expression host

• Induction conditions to maximize soluble protein yield

The catalytic efficiency of recombinant TMPRSS15 can vary significantly depending on the expression system used, with proper folding being critical for maintaining the spatial arrangement of the catalytic triad (His, Asp, Ser) in the active site.

What purification methods yield the highest purity and activity for recombinant pig enteropeptidase?

Purification of recombinant pig enteropeptidase typically involves multiple chromatography steps to achieve high purity while preserving enzymatic activity. Based on current research protocols, the following purification strategy is recommended:

• Affinity Chromatography: For His-tagged TMPRSS15, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins provides the initial capture step with good selectivity .

• Ion Exchange Chromatography: Following affinity purification, ion exchange chromatography (typically anion exchange) helps remove residual contaminants and endotoxins.

• Size Exclusion Chromatography: As a final polishing step, gel filtration separates any aggregates and ensures a homogeneous preparation.

Purification considerations:

• Buffer composition is critical, with optimal pH range typically between 7.0-8.0

• The addition of protease inhibitors during early purification stages prevents autoproteolysis

• Low temperatures (4°C) should be maintained throughout the purification process

• Purity assessment by SDS-PAGE typically aims for >90-95% purity

Activity preservation is crucial during purification, and specific activity assays should be performed after each purification step to monitor enzyme functionality. Commercial preparations typically achieve >90% purity as determined by SDS-PAGE .

How can researchers assess the enzymatic activity of purified recombinant pig enteropeptidase?

Several established methods can be used to assess the enzymatic activity of purified recombinant pig enteropeptidase:

• Chromogenic Substrate Assay:

  • Using synthetic peptide substrates containing the (Asp)4-Lys recognition sequence linked to a chromogenic group (e.g., p-nitroanilide)

  • Enzyme activity is quantified by spectrophotometric measurement of the released chromophore

  • This method allows for kinetic analysis to determine parameters such as Km and kcat

• Fluorogenic Substrate Assay:

  • Similar to chromogenic assays but with increased sensitivity

  • Uses substrates coupled to fluorescent groups like AMC (7-amino-4-methylcoumarin)

  • Allows for real-time monitoring of enzymatic activity

• Natural Substrate Conversion:

  • Monitoring the conversion of trypsinogen to trypsin

  • The generated trypsin activity can be measured using specific trypsin substrates

  • This approach reflects the physiological function more accurately

• SDS-PAGE Analysis:

  • Visualizing the cleavage of substrate proteins containing the enteropeptidase recognition sequence

  • Useful for qualitative assessment and confirming specificity

When performing activity assays, it's important to consider several critical factors:

• Optimal pH (typically 7.5-8.5)

• Temperature dependence (usually 25-37°C)

• Divalent cation requirements (particularly Ca²⁺)

• Potential inhibitors present in the buffer system

How does recombinant pig enteropeptidase compare structurally and functionally to human TMPRSS15?

Pig (Sus scrofa) and human enteropeptidase share significant structural and functional similarities, but also exhibit important differences that researchers should consider:

Structural Comparison:

• Sequence homology: Approximately 80% amino acid identity in the catalytic domain

• Domain organization: Both contain the characteristic domain architecture (TM, SEA, LDLR, C1r/s, MAM, and serine protease domains)

• Active site configuration: The catalytic triad (His, Asp, Ser) is highly conserved

Functional Comparison:

• Substrate specificity: Both preferentially cleave after the sequence (Asp)4-Lys, though subtle differences in efficiency may exist

• Catalytic efficiency: Generally comparable kcat/Km values for similar substrates

• Inhibition profiles: Similar susceptibility to serine protease inhibitors, but potentially different binding affinities

When considering which variant to use in research, the specific experimental question and required properties should guide the choice between pig and human TMPRSS15.

What are the critical domains of TMPRSS15 that affect its catalytic function, and how can these be studied using recombinant proteins?

TMPRSS15 contains multiple domains that collectively contribute to its proper localization, substrate recognition, and catalytic function. Understanding these domains is crucial for structure-function studies:

Key Functional Domains:

• Serine Protease Domain: Contains the catalytic triad (His, Asp, Ser) responsible for the hydrolytic activity. Mutations in this domain, such as the p.Val799Asp variant described in the literature, can significantly impair enzymatic function .

• LDLR (LDL Receptor-like) Domain: Important for proper protein folding and potentially involved in substrate recognition. Exon 16 skipping in this domain, as observed with the c.1921G>A variant, can lead to a protein lacking 47 amino acids in the LDLR domain, affecting functionality .

• SEA (Sea Urchin Sperm Protein, Enterokinase, Agrin) Domain: Likely involved in protein-protein interactions.

• MAM (Meprin, A5 Protein, Receptor Protein-Tyrosine Phosphatase Mu) Domain: May contribute to protein folding and stability.

Research Approaches to Study Domain Functions:

By systematically studying these domains using recombinant proteins, researchers can gain insights into the molecular mechanisms underlying TMPRSS15 function and regulation, which is particularly important for understanding disorders like enteropeptidase deficiency.

How can researchers design inhibitors specific to recombinant pig enteropeptidase for functional studies?

Designing specific inhibitors for recombinant pig enteropeptidase requires a systematic approach that leverages structural insights and medicinal chemistry principles:

Rational Inhibitor Design Strategies:

• Structure-Based Design:

  • Utilizing X-ray crystallography data of the enzyme's active site

  • Computational modeling to predict binding interactions

  • Virtual screening of compound libraries to identify potential scaffolds

• Substrate-Based Approach:

  • Developing peptidomimetic inhibitors based on the natural (Asp)4-Lys recognition sequence

  • Incorporating non-hydrolyzable bonds at the cleavage site

  • Adding reactive groups (e.g., chloromethyl ketones, boronic acids) that form covalent bonds with active site residues

• Screening Methods:

  • High-throughput screening assays using fluorogenic or chromogenic substrates

  • Fragment-based screening to identify smaller molecular entities with binding potential

  • Phage display technology to identify peptide-based inhibitors

Drawing parallels from TMPRSS2 inhibitor research, which has yielded compounds with half-maximal inhibitory concentrations ranging from 1.4 nM to 120 μM, similar approaches could be applied to TMPRSS15 . The development of selective inhibitors requires careful consideration of the distinguishing features of the TMPRSS15 substrate binding pocket that explain specificity.

For validation of inhibitor mechanisms, researchers should consider:

• Enzyme kinetics (competitive vs. non-competitive inhibition)

• Binding studies (isothermal titration calorimetry, surface plasmon resonance)

• Structural analysis of enzyme-inhibitor complexes

• Cellular assays to confirm target engagement in more complex systems

What are common challenges in expressing and purifying active recombinant pig enteropeptidase and how can they be addressed?

Researchers often encounter several challenges when working with recombinant pig enteropeptidase. Here are the most common issues and recommended solutions:

Challenge 1: Low Expression Yield

• Possible causes: Suboptimal codon usage, protein toxicity, formation of inclusion bodies

• Solutions:

  • Optimize codon usage for the expression host

  • Use tightly regulated expression systems (e.g., T7 promoter with glucose repression)

  • Lower induction temperature (16-25°C) to slow protein synthesis and improve folding

  • Co-express molecular chaperones to aid protein folding

Challenge 2: Protein Insolubility/Inclusion Body Formation

• Possible causes: Improper folding, hydrophobic interactions, high expression rates

• Solutions:

  • Reduce induction temperature and IPTG concentration

  • Include solubility-enhancing fusion partners (SUMO, MBP, GST)

  • Optimize buffer conditions during cell lysis (detergents, higher salt)

  • Develop effective refolding protocols if inclusion bodies are unavoidable

Challenge 3: Proteolytic Degradation

• Possible causes: Auto-proteolysis, host cell proteases

• Solutions:

  • Add protease inhibitors during purification

  • Express as an inactive zymogen form

  • Use protease-deficient host strains

  • Optimize purification speed to minimize degradation time

Challenge 4: Low Enzymatic Activity

• Possible causes: Improper folding, missing cofactors, buffer incompatibility

• Solutions:

  • Ensure presence of calcium ions in activity buffers

  • Verify correct disulfide bond formation

  • Optimize buffer pH and ionic strength

  • Validate protein folding through circular dichroism or limited proteolysis

Challenge 5: Batch-to-Batch Variability

• Possible causes: Inconsistent expression/purification conditions, variable cell growth

• Solutions:

  • Standardize all protocols with detailed SOPs

  • Implement robust quality control measures (activity assays, SDS-PAGE)

  • Prepare master cell banks for consistent starting material

  • Consider automated purification systems to reduce operator variability

When reconstituting lyophilized protein, carefully follow the recommended procedures to maintain enzymatic activity, including centrifuging vials before opening and reconstituting to appropriate concentrations (0.1-1.0 mg/mL) .

How can researchers optimize the cleavage efficiency of recombinant pig enteropeptidase for fusion protein applications?

Optimizing cleavage efficiency is critical when using recombinant pig enteropeptidase for fusion protein applications. The following methodological approaches can significantly improve results:

Optimization Parameters:

• Enzyme-to-Substrate Ratio:

  • Start with manufacturer-recommended ratios (typically 1:50 to 1:200 w/w)

  • Perform small-scale optimization experiments to determine the minimum amount of enzyme needed

  • Consider that too high enzyme concentrations may cause non-specific cleavage

• Reaction Conditions:

  • Temperature: Typically 22-25°C for standard reactions, but can be optimized between 16-37°C

  • Time: Monitor cleavage over time (2, 4, 8, 16, 24 hours) to determine optimal duration

  • pH: Test range from 7.0 to 8.5 with optimal activity typically around pH 7.4-8.0

  • Buffer components: Include 2-10 mM CaCl₂, which enhances enzymatic activity

• Target Protein Considerations:

  • Ensure the recognition sequence (Asp)₄-Lys is fully accessible

  • Minimize structural elements that might sterically hinder access to the cleavage site

  • Consider adding flexible linkers around the cleavage sequence

• Cleavage Evaluation Methods:

  • SDS-PAGE analysis to visualize cleavage efficiency

  • Western blotting if appropriate antibodies are available

  • Mass spectrometry to confirm precise cleavage site

A systematic optimization protocol might include:

• Initial small-scale reactions with varying enzyme:substrate ratios

• Time-course analysis with the most promising ratio

• Fine-tuning of buffer conditions (pH, salt, calcium concentration)

• Scaling up using optimized conditions with appropriate controls

When working with difficult-to-cleave fusion proteins, consider adding mild denaturants (0.5-1 M urea) or detergents (0.05-0.1% Triton X-100) to improve accessibility of the cleavage site without significantly affecting enzyme activity.

What analytical methods are most effective for characterizing the structural properties of recombinant pig enteropeptidase?

Comprehensive characterization of recombinant pig enteropeptidase requires multiple analytical techniques to assess different structural aspects:

Primary Structure Analysis:

• Mass Spectrometry (MS):

  • Peptide mass fingerprinting after enzymatic digestion

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for sequence confirmation

  • Intact protein mass determination to verify full-length expression

  • Example application: Verification that the recombinant protein matches the expected amino acid sequence (LGKSHEARGTMKITSGVTYNPNLQDKLSVDFKVLAFDIQQMIGEIFQSSNLKNEYKNSRVLQFENGSVIVIFDLLFAQWVSDENIKEELIQGIEANKSSQLVAFHIDVNSIDITESL)

• N-terminal Sequencing:

  • Edman degradation to confirm correct processing of the N-terminus

  • Particularly important when verifying signal peptide cleavage

Secondary and Tertiary Structure Analysis:

• Circular Dichroism (CD) Spectroscopy:

  • Far-UV CD (190-250 nm) for secondary structure content (α-helices, β-sheets)

  • Near-UV CD (250-350 nm) for tertiary structure fingerprinting

  • Thermal denaturation studies to assess stability

• Fourier-Transform Infrared Spectroscopy (FTIR):

  • Complementary to CD for secondary structure determination

  • Particularly useful for proteins with high β-sheet content

• Fluorescence Spectroscopy:

  • Intrinsic tryptophan fluorescence for tertiary structure assessment

  • Fluorescence resonance energy transfer (FRET) for domain proximity studies

Hydrodynamic Properties:

• Size Exclusion Chromatography (SEC):

  • Assessment of oligomeric state and homogeneity

  • Detection of aggregates or degradation products

• Dynamic Light Scattering (DLS):

  • Determination of hydrodynamic radius

  • Monitoring protein aggregation tendencies

• Analytical Ultracentrifugation (AUC):

  • Precise molecular weight determination

  • Analysis of self-association behavior

Structural Determination:

• X-ray Crystallography:

  • High-resolution structural information

  • Co-crystallization with substrates or inhibitors to understand binding interactions

  • Similar approaches to those used for TMPRSS2 structure determination at 1.95 Å resolution

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Solution structure determination

  • Dynamics studies to understand flexible regions

A comprehensive characterization strategy would typically include SDS-PAGE for purity assessment (>90-95%), followed by mass spectrometry for identity confirmation, and selected biophysical techniques based on the specific research questions .

How can recombinant pig enteropeptidase be used in studying enteropeptidase deficiency (EKD) and potential therapeutic approaches?

Recombinant pig enteropeptidase serves as a valuable tool in investigating enteropeptidase deficiency (EKD), a rare autosomal recessive disorder characterized by diarrhea and failure to thrive due to impaired protein digestion. Research applications in this area include:

Disease Mechanism Studies:

• Functional Characterization of TMPRSS15 Variants:

  • Recombinant expression of wild-type and mutant variants allows direct comparison of enzymatic activities

  • Assessment of how specific mutations (such as c.1921G>A and c.2396T>A) affect protein function

  • Investigation of domain-specific effects, such as exon 16 skipping leading to a protein lacking 47 amino acids in the LDLR domain

• Splicing Defect Analysis:

  • Minigene splicing assays to investigate how specific mutations affect RNA processing

  • Comparison of wild-type and mutant constructs to quantify splicing alterations

Therapeutic Development Approaches:

• Enzyme Replacement Therapy (ERT) Development:

  • Recombinant enteropeptidase could potentially serve as a treatment for EKD

  • Optimization of formulation for oral delivery to resist gastric degradation

  • Assessment of dosing requirements using animal models

• Drug Screening Platform:

  • Using recombinant enzyme to screen for small molecules that could restore function to mutant variants

  • Identification of pharmacological chaperones that might improve folding of misfolded variants

• Gene Therapy Model Systems:

  • Testing gene delivery approaches using cellular models of EKD

  • Validation of functional restoration through enzymatic activity assays

Research involving the c.2396T>A variant, which causes a valine-to-aspartic acid change in the serine protease domain, demonstrates how recombinant protein studies can provide insights into the molecular basis of EKD . This variant is located in a highly conserved region with bioinformatic predictions suggesting harmful effects on protein function, information that can guide therapeutic development efforts.

What are the considerations for using pig TMPRSS15 as a model for human enteropeptidase in drug development and inhibitor screening?

When using pig TMPRSS15 as a surrogate for human enteropeptidase in drug development and inhibitor screening, researchers should consider several important factors:

Similarities and Differences to Consider:

• Sequence and Structural Homology:

  • High sequence identity in the catalytic domain (approximately 80%)

  • Conserved active site architecture allows for reasonable extrapolation of inhibitor binding

  • Differences in surface residues may affect inhibitor accessibility and binding kinetics

• Substrate Specificity:

  • Both enzymes recognize the (Asp)₄-Lys sequence

  • Subtle differences in extended substrate recognition sites may exist

  • Comprehensive kinetic characterization with multiple substrates can help identify species-specific variations

• Inhibitor Binding Profiles:

  • Similar susceptibility to general serine protease inhibitors

  • Species-specific differences in binding pockets may affect inhibitor selectivity

  • Cross-species validation is essential for any promising inhibitor candidates

Recommended Validation Approach:

Learning from approaches used with TMPRSS2, where inhibitors with half-maximal inhibitory concentrations ranging from 1.4 nM to 120 μM have been identified, similar strategies could be employed for TMPRSS15 inhibitor development . Understanding the distinguishing features of the substrate binding pocket is essential for developing selective inhibitors over other serine proteases.

A parallel testing strategy using both species' enzymes throughout the development process provides the most robust approach to ensure that findings in the pig model translate effectively to human applications.

What are the future research directions for recombinant pig enteropeptidase in basic and applied sciences?

The study of recombinant pig enteropeptidase (TMPRSS15) continues to evolve, with several promising research directions emerging at the intersection of basic science and applied biotechnology:

Basic Science Frontiers:

• Structural Biology: Obtaining high-resolution crystal structures of full-length TMPRSS15 would significantly advance our understanding of its activation mechanism and substrate recognition. The success in obtaining TMPRSS2 structures at 1.95 Å resolution provides a methodological template for similar work with TMPRSS15 .

• Regulatory Mechanisms: Investigation of post-translational modifications and protein-protein interactions that regulate enteropeptidase activity in vivo represents an important knowledge gap.

• Comparative Enzymology: Systematic comparison of enteropeptidase from different species could reveal evolutionary adaptations in digestive enzyme systems and provide insights into structure-function relationships.

Applied Science and Biotechnology:

• Engineered Variants: Development of recombinant TMPRSS15 with enhanced stability, altered specificity, or improved expression characteristics could expand its biotechnological applications.

• Immobilization Technologies: Creating reusable enteropeptidase biocatalysts through various immobilization strategies could improve cost-effectiveness for industrial applications.

• Therapeutic Development: Research into enzyme replacement therapies for enteropeptidase deficiency (EKD) could benefit from improved recombinant production and formulation technologies .

Emerging Methodologies:

• Directed Evolution: Application of directed evolution approaches to enhance specific properties of TMPRSS15 for biotechnological applications.

• Systems Biology: Integration of enteropeptidase into broader models of digestive physiology and disease states.

• Computational Design: Structure-based computational approaches to design novel substrates or inhibitors with enhanced specificity.

As our understanding of enteropeptidase continues to grow, the research community can anticipate more sophisticated applications in protein engineering, diagnostics, and therapeutic development, building upon the foundation of knowledge established through work with recombinant pig TMPRSS15.

What are the key differences between research-grade and therapeutic-grade recombinant enteropeptidase preparations?

Research-grade and therapeutic-grade recombinant enteropeptidase preparations differ substantially in their production requirements, quality standards, and regulatory considerations:

Production and Manufacturing:

Quality Attributes and Testing:

Regulatory Considerations:

• Research-Grade:

  • Limited regulatory oversight

  • Focus on reproducibility and basic safety

  • Products labeled "For Research Use Only"

• Therapeutic-Grade:

  • Extensive regulatory requirements (FDA/EMA)

  • Complete Chemistry, Manufacturing, and Controls (CMC) documentation

  • Required adherence to Pharmacopeial standards

  • Clinical-grade materials require Investigational New Drug (IND) approval

The transition from research-grade to therapeutic-grade recombinant enteropeptidase would require significant investment in process development, analytical method validation, and manufacturing infrastructure. This understanding is crucial for researchers considering translational applications of their work with recombinant TMPRSS15.