Recombinant Pig Fetal and adult testis-expressed transcript protein homolog (FATE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FATE1; FATE; Fetal and adult testis-expressed transcript protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
FATE1
Target Protein Sequence
MAGGSTNTKKIEMSLAEELVPKSQEPSREQVLIAEMLEHGIRSLGASQSRQKLDSKISDS AAAWNLAANKSKKTGPQLPPKKASQEPNQEGGFQGMGFLYERNLGADVIAEIGLEELNGL EMEIMRRQLQVITGRLRALEDQGATWRHRETLFFTMLVSVCVANLWLWLRQ
Uniprot No.

Target Background

Function
FATE1 plays a regulatory role in endoplasmic reticulum (ER)-mitochondria coupling. It negatively regulates ER-mitochondria distance and Ca²⁺ transfer from the ER to mitochondria, potentially influencing apoptosis regulation. FATE1 may collaborate with RNF183 to control BIK protein levels, thereby modulating apoptotic signaling.
Database Links

KEGG: ssc:396705

UniGene: Ssc.81

Subcellular Location
Mitochondrion. Mitochondrion outer membrane. Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is FATE1 and what are its primary biological functions?

FATE1 (fetal and adult testis expressed 1) is a protein expressed predominantly in testis tissues and various tumor tissues. It functions primarily as a survival factor in tumor cells through two principal mechanisms: mediating the degradation of the pro-apoptotic BH3-only protein Bik and promoting ER-mitochondrial uncoupling . Research has established that FATE1 shares significant sequence homology with the mitochondrial Drp1 receptor MFF (mitochondrial fission factor), suggesting evolutionary relationships between these proteins .

Methodological approach for studying FATE1's functions:

  • Subcellular localization studies using immunofluorescence microscopy

  • Co-immunoprecipitation experiments to identify binding partners

  • Knockout/knockdown studies followed by apoptosis assays

  • Mitochondrial morphology assessment through live-cell imaging

How does porcine FATE1 compare structurally and functionally to human FATE1?

While the search results don't provide direct comparison data between porcine and human FATE1, research methodologies for such comparative studies would involve:

  • Sequence alignment analysis showing:

    • Percent identity of amino acid sequences

    • Conservation of functional domains

    • Species-specific variations in key regions

  • Functional assay comparison:

    • Expression patterns across tissue types

    • Interaction with binding partners (e.g., Mfn2 versus Mfn1)

    • Effects on mitochondrial dynamics

  • Recombinant protein production differences:

    • Expression systems (bacterial, mammalian, insect cell)

    • Purification yields

    • Post-translational modifications

Such comparative studies would likely demonstrate evolutionary conservation of core functions while highlighting species-specific adaptations, similar to studies of other cancer-testis antigens in various model organisms.

What techniques are most effective for detecting FATE1 expression in porcine tissues?

Based on research methodologies referenced in similar studies, the following techniques would be recommended for FATE1 detection:

TechniqueApplicationAdvantagesLimitations
qRT-PCRmRNA expressionHigh sensitivity, quantitativeDoesn't measure protein levels
Western blottingProtein expressionSize verification, semi-quantitativeLower sensitivity than PCR
ImmunohistochemistryTissue localizationSpatial information in intact tissuesAntibody specificity challenges
RNA-SeqTranscriptome-wide expressionUnbiased, discovers novel transcriptsComplex data analysis

For porcine tissues specifically, researchers should consider:

  • Optimizing RNA extraction protocols for fatty tissues like testis

  • Validating antibody cross-reactivity between human and porcine FATE1

  • Including appropriate tissue-specific controls (especially normal testis versus tumor samples)

How does FATE1 regulate mitochondrial morphology during apoptosis, and what are the implications for cancer therapy resistance?

FATE1 has been shown to promote mitochondrial hyperfusion and support maintenance of mitochondrial networks following apoptosis stimulation . Unlike its homolog MFF, FATE1 does not recruit Drp1 to mitochondria, and instead promotes hyperfusion of mitochondrial networks through mechanisms likely involving the mitochondrial fusion protein Mfn2, but not Mfn1 .

Research methodologies to investigate this function include:

  • Live-cell imaging of mitochondrial dynamics using fluorescent markers

  • FATE1 overexpression/knockdown studies followed by apoptosis induction

  • Co-immunoprecipitation assays to identify protein-protein interactions

  • Mitochondrial fragmentation assays using apoptosis inducers like TNF and valinomycin

The data indicates that FATE1-overexpressing cancer cells demonstrate increased resistance to mitochondrial fragmentation when treated with TNF and valinomycin, suggesting FATE1 as a novel regulator of mitochondrial morphology changes during apoptosis . This property may contribute to FATE1-mediated resistance of cancer cells to chemotherapy, as mitochondrial fragmentation is a key step in the intrinsic apoptotic pathway.

What experimental designs are most appropriate for studying FATE1's role in fetal porcine development?

Based on approaches used in related developmental studies, factorial experimental designs would be most appropriate . A properly designed study would include:

  • Fractional factorial design parameters:

    • Multiple gestational time points (e.g., 30, 44, 60, 90 days)

    • FATE1 expression manipulation (knockout, overexpression, control)

    • Tissue types (placenta, fetal tissues, maternal interfaces)

Design TypeNumber of FactorsNumber of RunsResolutionAppropriate Use Case
Full factorial38FullWhen all combinations are feasible
Fractional factorial (1/2)34IVInitial screening of factors
Response surface315VWhen modeling nonlinear relationships

Such designs would enable researchers to identify:

  • Critical developmental time points for FATE1 expression

  • Tissue-specific effects

  • Potential interaction effects between factors

Similar to studies on recombinant porcine somatotropin (rpST), researchers could measure outcomes such as fetal weight, placental weight, and growth factor concentrations to assess FATE1's developmental impacts .

How do genetic variations in porcine FATE1 correlate with fertility traits and developmental outcomes?

To investigate correlations between FATE1 genetic variations and phenotypic traits, researchers should employ genome-wide association studies (GWAS) integrated with tissue-specific transcriptome analyses . Methodological approaches would include:

  • SNP identification and genotyping in diverse pig populations

  • Transcriptome sequencing of reproductive tissues

  • Phenotypic data collection on:

    • Litter size

    • Embryo survival rates

    • Testicular development parameters

    • Spermatogenesis efficiency

Analysis would involve:

  • Identification of QTLs associated with FATE1 variations

  • Integration of transcriptome data to identify co-expressed gene networks

  • Pathway analysis to determine signaling mechanisms affected

This integrated approach would help unravel the genetic architecture underlying FATE1's role in reproductive traits, similar to approaches used in Yorkshire pig studies examining feed conversion ratio traits .

What considerations should guide the design of recombinant porcine FATE1 expression systems?

For effective recombinant porcine FATE1 production, researchers should consider:

  • Expression system selection:

    • Mammalian systems (HEK293, CHO cells) preserve post-translational modifications

    • Bacterial systems (E. coli) offer higher yields but lack mammalian modifications

    • Baculovirus/insect cell systems balance yield with eukaryotic processing

  • Vector design elements:

    • Appropriate promoters (CMV for mammalian, T7 for bacterial)

    • Fusion tags for purification (His, GST, MBP)

    • Cleavage sites for tag removal

    • Kozak sequence optimization for translation efficiency

  • Purification strategy:

    • Initial capture by affinity chromatography

    • Secondary purification steps (ion exchange, size exclusion)

    • Endotoxin removal for in vivo applications

  • Quality control parameters:

    • SDS-PAGE for purity assessment

    • Western blotting for identity confirmation

    • Functional assays specific to FATE1's known activities

    • Endotoxin testing for in vivo applications

Lessons from recombinant porcine somatotropin (rpST) studies suggest that daily dose administration and gestational timing significantly affect biological outcomes, indicating the importance of protein stability and half-life considerations .

How should researchers design experiments to study FATE1's interaction with the mitochondrial fusion machinery?

Based on previous research on FATE1's role in mitochondrial morphology , appropriate experimental designs would include:

  • Co-immunoprecipitation studies:

    • Target proteins: Mfn1, Mfn2, OPA1, Drp1, MFF

    • Controls: IgG, reverse co-IP, competing peptides

    • Detection: Western blotting with specific antibodies

  • Proximity ligation assays:

    • Direct visualization of protein-protein interactions in situ

    • Quantification of interaction events per cell

    • Subcellular localization of interactions

  • Reconstitution experiments:

    • Use of Mfn1/Mfn2 knockout cells (as described in research )

    • Transfection with wild-type or mutant FATE1

    • Assessment of rescue phenotypes

  • Structure-function analyses:

    • Domain deletion/mutation constructs

    • Identification of critical residues for interaction

    • Correlation with functional outcomes

These approaches would generate data on whether FATE1 directly or indirectly affects mitochondrial fusion, the domains involved, and the physiological significance of these interactions.

What factorial design would best identify key parameters controlling FATE1 expression in porcine developmental studies?

Based on experimental design principles for biological systems , an optimal factorial design would include:

  • A fractional factorial design with the following factors:

    • Gestational age (levels: early, mid, late gestation)

    • Tissue type (levels: testis, placenta, liver, brain)

    • Genetic background (levels: different pig breeds)

    • Environmental factors (levels: normal, stressed conditions)

FactorLevel -1Level 0Level +1
Gestational age30 days60 days90 days
Tissue typeTestisPlacentaLiver
Genetic backgroundYorkshireDurocLandrace
Environmental conditionNormalModerate stressHigh stress
  • Response variables to measure:

    • FATE1 mRNA expression (qPCR)

    • FATE1 protein levels (Western blot)

    • Mitochondrial morphology parameters

    • Apoptosis markers

  • Design resolution considerations:

    • A Resolution IV design would allow estimation of main effects without confounding with two-factor interactions

    • Centre points should be included to check for curvature (non-linear responses)

    • Replicates to estimate experimental error

This approach would efficiently identify the most significant factors affecting FATE1 expression while minimizing the number of experimental conditions, similar to approaches used in other porcine developmental studies .

How should researchers interpret conflicting data on FATE1's role in apoptosis versus its function in mitochondrial dynamics?

When facing seemingly contradictory data about FATE1's functions, researchers should employ a systematic approach:

  • Context-dependent analysis:

    • Cell/tissue type differences (cancer vs. normal, embryonic vs. adult)

    • Species-specific variations (human vs. porcine FATE1)

    • Experimental conditions (acute vs. chronic, stress levels)

  • Temporal resolution analysis:

    • Time-course experiments to determine sequence of events

    • Pulse-chase studies to track protein dynamics

    • Live-cell imaging with dual markers for mitochondria and apoptosis

  • Integration of multiple methodologies:

    • Biochemical assays (e.g., co-IP, Western blot)

    • Microscopy techniques (confocal, super-resolution)

    • Genetic approaches (CRISPR/Cas9, RNAi)

    • Systems biology (proteomics, transcriptomics)

Research suggests that FATE1's dual roles in apoptosis resistance and mitochondrial hyperfusion may be mechanistically linked rather than contradictory. FATE1 promotes ER-mitochondrial uncoupling while simultaneously supporting maintenance of mitochondrial networks following apoptosis stimulation, which may represent different aspects of a unified cellular protection mechanism .

What statistical approaches are most appropriate for analyzing the effects of FATE1 manipulation in developmental pig models?

For robust statistical analysis of FATE1 studies in developmental pig models, researchers should consider:

  • Mixed-effects models to account for:

    • Fixed effects (treatment, time points, genotype)

    • Random effects (animal-to-animal variation, litter effects)

    • Repeated measures (longitudinal data)

  • Appropriate multiple comparison adjustments:

    • Tukey's HSD for all pairwise comparisons

    • Dunnett's test when comparing to a control group

    • Bonferroni or FDR correction for genome-wide studies

  • Power analysis considerations:

    • Preliminary data from pilot studies to estimate effect sizes

    • Sample size calculations based on expected biological variability

    • Accounting for potential loss of animals during gestation

  • Effect size reporting:

    • Mean differences with confidence intervals

    • Standardized effect sizes (Cohen's d, partial η²)

    • Visual representation using forest plots

These approaches align with statistical methods used in recombinant porcine somatotropin studies, where mixed models helped detect significant treatment effects on placental weight (71.20 ± 3.52 vs 58.35 ± 3.41 g; P < .02) and fetal weight (18.06 ± .55 vs 16.44 ± .53 g; P < .05) .

How can transcriptome analysis data be integrated with protein-level studies to better understand FATE1's regulatory networks?

Integration of transcriptomic and proteomic data for FATE1 studies requires sophisticated bioinformatic approaches:

  • Multi-omics data integration strategy:

    • RNA-Seq for transcriptome profiling

    • Proteomics for protein abundance and post-translational modifications

    • ChIP-Seq for transcription factor binding sites

    • Ribosome profiling for translation efficiency

  • Network analysis approaches:

    • Weighted gene co-expression network analysis (WGCNA)

    • Protein-protein interaction networks

    • Pathway enrichment analysis

    • Causal network inference

  • Visualization techniques:

    • Heat maps for expression patterns

    • Network diagrams for protein interactions

    • Pathway maps for functional relationships

  • Validation experiments:

    • Selected qRT-PCR for transcript validation

    • Western blots for protein validation

    • CRISPR perturbations of key network nodes

This integrated approach has been successfully applied in Yorkshire pig studies to identify quantitative trait loci and crucial signaling pathways related to feed conversion ratio, demonstrating that combining GWAS with transcriptome analyses enhances the power to identify candidate genes and key pathways .

How might FATE1 be studied in immunodeficient pig models to understand its role in tumor microenvironments?

To investigate FATE1 in tumor microenvironments using immunodeficient pig models, researchers should consider:

  • Selection of appropriate pig model:

    • IL2RG knockout pigs (deficient in T and NK cells)

    • RAG1/RAG2 knockout pigs (lacking mature B and T lymphocytes)

    • Combined immunodeficiency models for comprehensive immune cell depletion

  • Experimental design considerations:

    • Xenograft studies using human tumor cells with FATE1 manipulation

    • Comparison of tumor growth kinetics and metastatic potential

    • Analysis of tumor microenvironment immune infiltration

  • Assessment techniques:

    • Immunohistochemistry for FATE1 expression in tumors

    • Flow cytometry for immune cell characterization

    • Multiplex cytokine analysis for inflammatory mediators

    • Live imaging for tumor growth monitoring

This approach leverages the advantage that immunodeficient pig models, particularly RAG2 bi-allelic mutants, have been successfully used as alternatives to immunocompromised mice for assessing tumorigenicity . The similar immune reactions between pigs and humans make these models particularly valuable for translational research on FATE1's role in tumor development.

What are the most promising future research directions for porcine FATE1 studies in cancer and developmental biology?

Based on current research, the most promising future directions include:

  • Therapeutic targeting strategies:

    • Development of small molecule inhibitors of FATE1

    • Evaluation of FATE1 as a cancer immunotherapy target

    • Investigation of synthetic lethality approaches

  • Developmental biology applications:

    • FATE1's role in embryo implantation and placental development

    • Effects on mitochondrial dynamics during cellular differentiation

    • Transgenerational epigenetic regulation of FATE1 expression

  • Comparative medicine approaches:

    • Parallel studies in human and porcine systems

    • Translation of findings from pig models to human clinical applications

    • Development of porcine cancer models with FATE1 manipulations

  • Advanced methodological approaches:

    • CRISPR/Cas9 genome editing to create precise FATE1 mutations

    • Single-cell transcriptomics to reveal cell-type specific functions

    • Organoid models to study FATE1 in complex tissue contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.