Recombinant Pig G protein-activated inward rectifier potassium channel 4 (KCNJ5)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Pig KCNJ5

Recombinant Pig G protein-activated inward rectifier potassium channel 4 (KCNJ5) refers to the engineered expression of the KCNJ5 gene product in porcine models or cell systems. KCNJ5 is a G protein-gated potassium channel critical for regulating membrane potential in adrenal glands, heart, and other tissues. In pigs, this channel is harnessed to study pathologies like primary aldosteronism (PA) and long QT syndrome, leveraging its high expression in adrenal zona glomerulosa (zG) cells .

Recombinant Production and Biochemical Characteristics

KCNJ5 is produced via recombinant DNA technology in hosts such as E. coli, yeast, or mammalian cells (e.g., HEK293). Key features include:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells (e.g., HEK293)
Purity≥85% (SDS-PAGE validated)
ApplicationsWestern blot, immunohistochemistry, functional assays, drug screening
Molecular Weight~47,667 Da (human reference)
Theoretical pI4.96

Recombinant pig KCNJ5 retains structural fidelity, forming tetrameric complexes with other subunits (e.g., KCNJ3) to enable Gβγ-mediated activation .

Ion Conduction and Gating

KCNJ5 facilitates inward potassium flux, with rectification due to Mg²⁺/polyamine block at depolarized potentials . In pigs, KCNJ5 mutations (e.g., G151R) disrupt voltage gating, causing constitutive channel activity and hyperaldosteronism .

Primary Aldosteronism (PA) Studies

Pigs with KCNJ5G151R/+ knock-in mutations mimic familial hyperaldosteronism type III, enabling:

  1. Pharmacological Testing: Macrolides (e.g., roxithromycin, clarithromycin) inhibit mutant channels. Clarithromycin reduces aldosterone production in vitro, while roxithromycin shows limited efficacy .

  2. Mechanistic Insights: Mutant KCNJ5 increases CYP11B2 (aldosterone synthase) expression via calcium signaling, bypassing normal GPCR regulation .

StudyMutationOutcomeInhibitors Tested
157-159delITE↑ Aldosterone production; ↓ efficacy of roxithromycinRoxithromycin, clarithromycin, nifedipine
G151RConstitutive channel activity; model for PA drug screeningMacrolides (roxithromycin)

Comparative Expression

Pigs exhibit high KCNJ5 expression in adrenal zG, unlike rodents, making them superior models for studying human PA .

Interactions and Pathological Relevance

  • Protein Partners: Co-assembles with KCNJ3 to form heterotetramers .

  • Disease Links:

    • Primary Aldosteronism: KCNJ5 mutations cause autonomous aldosterone secretion .

    • Long QT Syndrome: Gain-of-function mutations prolong cardiac repolarization .

Table 1: Recombinant KCNJ5 Products

HostPuritySourceApplicationsReference
E. coli≥85%Creative BioMartWestern blot, ELISA
Mammalian cells≥85%MyBioSourceFunctional assays, drug testing

Table 2: Research Highlights

StudyKey FindingReference
Gβγ activation mechanismGβγ induces TM2 helix bending to open GIRK channels .
Macrolide efficacyClarithromycin inhibits mutant KCNJ5, but roxithromycin lacks efficacy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
KCNJ5; G protein-activated inward rectifier potassium channel 4; GIRK-4; Cardiac inward rectifier; CIR; Heart KATP channel; Inward rectifier K(+ channel Kir3.4; KATP-1; Potassium channel, inwardly rectifying subfamily J member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-419
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKC NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNA FMVGCMFVKISQPKKRAETLMFSNHAVISLRDEKLCLMFRVGDLRNSHIVEASIRAKLIK SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLNQEEFE VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP SCCAKELAEMKREGRLLQYLPSPPLPGGCAGAELEAEAEQEGEDEPEGLRGSRETRDSV
Uniprot No.

Target Background

Function

This G protein-activated inward rectifier potassium channel (GIRK) belongs to the KCNJ5 family. GIRKs are characterized by their preferential inward potassium current, facilitating potassium influx into the cell. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation voltage to more positive potentials. Inward rectification is primarily attributed to intracellular magnesium block. The channel is susceptible to blockade by extracellular barium.

Gene References Into Functions
  1. Morphine-induced delayed preconditioning protects against ischemia/reperfusion injury in pulmonary artery endothelial cells (PAECs) via mitochondrial ATP-sensitive potassium (KATP) channels in an opioid receptor-dependent manner. PMID: 26648415
  2. KATP channel blockade reduced flow debt repayment by approximately 45% in lean swine, but not in those with metabolic syndrome. PMID: 20118408
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ5 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is KCNJ5 and what are its alternative nomenclatures in scientific literature?

KCNJ5 (G protein-activated inward rectifier potassium channel 4) is also known by several alternative names in scientific literature, including GIRK4, CIR (Cardiac inward rectifier), KATP1, KIR3.4, and in relation to specific conditions, LQT13. These nomenclatures reflect its various functional roles and historical characterization across different research contexts. In the pig, it is primarily designated as KCNJ5, though it may occasionally be referred to by its functional name (G protein-activated inward rectifier potassium channel 4) in comparative studies . Understanding these designations is essential when conducting comprehensive literature reviews to ensure all relevant studies are captured in your research.

How does porcine KCNJ5 compare structurally and functionally to human KCNJ5?

Porcine KCNJ5 demonstrates significant structural and functional homology to human KCNJ5, making it an excellent model for translational research. The channel shares key structural domains with its human counterpart, particularly in the pore region and G-protein binding sites. Functionally, both porcine and human KCNJ5 are expressed in the adrenal zona glomerulosa, where they regulate membrane potential and subsequently aldosterone production. This similarity is notably superior to rodent models, which express minimal KCNJ5 in adrenal tissue . The conservation of functional domains between pig and human KCNJ5 is particularly evident in the G151 region, where mutations are associated with primary aldosteronism in humans, allowing for meaningful disease modeling in porcine systems.

What is the typical expression profile of KCNJ5 in porcine tissues?

KCNJ5 in pigs shows a tissue-specific expression profile with predominant expression in the adrenal zona glomerulosa, similar to humans. Unlike rodent models, pigs express significant amounts of KCNJ5 in the adrenal gland, which is critical for aldosterone regulation . This expression pattern makes porcine models particularly relevant for studying adrenal pathophysiology. Other tissues with notable KCNJ5 expression include cardiac tissue, where it functions as a cardiac inward rectifier (hence one of its alternative names, CIR), and certain regions of the central nervous system. The expression profile follows developmental patterns, with expression levels changing during different life stages, which should be considered when designing age-specific studies.

What are the optimal expression systems for producing functional recombinant pig KCNJ5?

For producing functional recombinant pig KCNJ5, researchers have successfully employed multiple expression systems, each with distinct advantages depending on research objectives. For basic structural and binding studies, E. coli-based expression systems offer high yield and cost-effectiveness, though post-translational modifications will be limited . For functional studies requiring proper protein folding and post-translational modifications, mammalian cell expression systems (particularly HEK293 or CHO cells) provide the most physiologically relevant recombinant protein. Baculovirus expression systems offer a middle ground, with moderate yield and some post-translational modifications. Cell-free expression systems are increasingly utilized for rapid production, particularly for screening studies . The choice of expression system should be guided by whether structural integrity, functional activity, or production scale is prioritized in your experimental design.

What purification strategies yield the highest functional activity for recombinant pig KCNJ5?

Purification of recombinant pig KCNJ5 with preserved functional activity requires careful methodology selection. Initial capture typically employs affinity chromatography using His-tag or GST-tag systems, depending on the fusion construct design. This should be followed by ion exchange chromatography to separate differentially charged species and remove contaminants. For maintaining functional activity, it's crucial to include stabilizing agents such as glycerol (10-15%) and specific detergents (DDM or LMNG at critical micelle concentrations) throughout purification. Size exclusion chromatography as a final polishing step helps achieve >85% purity while preserving native tetrameric structure . Researchers should verify functional integrity through electrophysiological assays following purification, as channel activity is sensitive to purification conditions.

How can researchers effectively validate antibody specificity for pig KCNJ5 in immunological applications?

Validating antibody specificity for pig KCNJ5 requires a multi-tiered approach to ensure experimental reliability. Begin with western blot analysis comparing wild-type tissue with KCNJ5-deficient controls (ideally from knockout models) to confirm band specificity at the expected molecular weight (approximately 45 kDa). For immunohistochemistry applications, include both positive controls (adrenal tissue known to express KCNJ5) and negative controls (tissues with verified absence of expression) . Cross-reactivity testing against other KCNJ family members is essential due to sequence homology. Additionally, peptide competition assays using the immunizing peptide can further confirm specificity. For applications involving KCNJ5 mutations, validation should include testing against both wild-type and mutant forms to ensure comparable binding affinity. Finally, comparing results across antibodies targeting different epitopes provides additional confidence in specificity.

What are the critical parameters for successful CRISPR/Cas9-mediated KCNJ5 modification in porcine models?

Successful CRISPR/Cas9-mediated KCNJ5 modification in porcine models requires careful optimization of several parameters. Guide RNA design is critical—target sequences with minimal off-target potential while maximizing on-target efficiency, ideally with prediction scores >0.7 using algorithms like Doench or Hsu scoring. For knock-in mutations like G151R, designing homology-directed repair templates with at least 800bp homology arms on each side significantly improves integration efficiency . The delivery method significantly impacts success rates—nucleofection of ribonucleoprotein complexes typically achieves 5-6% editing efficiency in porcine fibroblasts, comparable to prime editing approaches (around 5.2%) . Verification of modifications should employ digital PCR for accurate quantification of editing events rather than standard PCR. For generating viable animals, edited cell selection and expansion prior to somatic cell nuclear transfer (SCNT) is essential, with expected blastocyst rates of approximately 12% regardless of editing approach . Screening multiple embryos is necessary as mosaicism remains a significant challenge in this system.

How should researchers design experiments to characterize KCNJ5 channel activity in recombinant systems?

Characterizing KCNJ5 channel activity requires comprehensive electrophysiological and biochemical approaches. For patch-clamp analysis, whole-cell configuration with physiologically relevant K+ gradients (140mM intracellular, 5mM extracellular) provides baseline measurements of inward rectification properties. Recording protocols should include voltage steps from -120mV to +40mV to capture the full rectification curve. G-protein modulation studies should include GTPγS in pipette solutions (100μM) to evaluate channel regulation. For higher-throughput characterization, fluorescent voltage-sensitive dye assays using DiBAC4(3) can complement electrophysiology. Protein-protein interaction studies using co-immunoprecipitation should target known KCNJ5 interactors including G-protein βγ subunits and PIP2. Surface expression quantification using biotinylation assays or confocal imaging with membrane markers provides essential trafficking data. Lastly, functional comparisons between wild-type and mutant channels should include selectivity measurements, as pathogenic mutations typically alter Na+ permeability.

What controls are essential when analyzing KCNJ5 expression patterns in pig tissue samples?

Rigorous control implementation is critical when analyzing KCNJ5 expression in pig tissues. Include positive control tissues with established KCNJ5 expression (adrenal zona glomerulosa) and negative controls (tissues known to lack expression such as skeletal muscle) in every experimental batch. For protein-level analyses, technical controls must include primary antibody omission and isotype controls to account for non-specific binding . For transcriptional analyses, include multiple reference genes (GAPDH, ACTB, and a tissue-specific stable transcript) to normalize expression data appropriately. Age-matched controls are essential due to developmental changes in KCNJ5 expression. When comparing wild-type to genetically modified models, littermate controls provide the most rigorous comparison by minimizing genetic background effects . Spatial expression analyses should include co-staining with zona glomerulosa markers (CYP11B2) to confirm localization to aldosterone-producing cells. RNA integrity verification (RIN >8) is necessary for accurate transcriptional analyses.

How does recombinant pig KCNJ5 compare pharmacologically to human and rodent orthologs?

Recombinant pig KCNJ5 demonstrates pharmacological properties that more closely align with human KCNJ5 than rodent orthologs. When examining response to classic inward rectifier blockers like barium and cesium, pig KCNJ5 exhibits IC50 values within 15% of human values, while rodent channels show 2-3 fold differences in sensitivity. For G-protein modulation, both pig and human channels respond robustly to Gβγ activation, whereas rodent channels show attenuated responses. Most significantly for translational pharmacology, pig KCNJ5 mutations like G151R respond to macrolide antibiotics such as roxithromycin similarly to human mutant channels, making porcine models valuable for testing therapeutic interventions . This pharmacological homology extends to pH sensitivity and phosphoinositide regulation. These similarities make recombinant pig KCNJ5 a superior model for screening potential human therapeutics compared to rodent channels.

What are the key differences in experimental approaches when working with pig versus human KCNJ5?

Working with pig versus human KCNJ5 necessitates several experimental adjustments despite their similarities. For antibody-based detection, epitope differences require validation of cross-reactivity, with some commercial antibodies showing variability in recognition efficiency between species . When designing functional studies, pig KCNJ5 demonstrates approximately 10-15% higher single-channel conductance than human KCNJ5, requiring adjustment of electrophysiological protocols. For genome editing approaches, porcine cells typically require higher transfection reagent concentrations and modified nucleofection parameters compared to human cell lines . In tissue-level studies, the porcine adrenal zona glomerulosa is architecturally more defined than in humans, allowing for more precise microdissection. For phenotypic analysis of KCNJ5 mutations, blood pressure measurement in porcine models shows greater intra- and inter-individual variability than human studies, necessitating larger sample sizes and repeated measurements to achieve statistical power .

How informative are pig KCNJ5 studies for understanding human channelopathies and disease mechanisms?

Pig KCNJ5 studies provide exceptionally relevant insights into human channelopathies due to high structural, functional, and physiological similarities between the species. The successful generation of KCNJ5G151R/+ knock-in pigs has demonstrated that these animals develop a primary aldosteronism phenotype highly consistent with human pathophysiology, including elevated aldosterone-to-renin ratios (approximately 2.4-fold higher than wild-type), a key diagnostic marker in humans . Histological changes in porcine adrenal glands with KCNJ5 mutations mirror human pathology, showing reduced KCNJ5 staining and early signs of hyperplasia. Cardiovascular consequences, including trends toward elevated blood pressure and significantly increased heart rates, parallel human clinical presentations . The pig model's larger size permits longitudinal sampling and more sophisticated physiological monitoring than rodent models. Additionally, porcine adrenal expression patterns of KCNJ5 match human patterns, while rodents express minimal amounts in these tissues, making pig models uniquely valuable for translational aldosteronism research .

How accurately do porcine KCNJ5 mutations model primary aldosteronism phenotypes?

Porcine KCNJ5 mutation models demonstrate remarkable fidelity in recapitulating human primary aldosteronism phenotypes. KCNJ5G151R/+ knock-in pigs develop significantly elevated aldosterone-to-renin ratios (ARR) by 23 weeks of age compared to wild-type controls (KI: 1.17 ± 0.41 vs. WT: 0.48 ± 0.14, p < 0.05), mirroring the cardinal diagnostic feature of human primary aldosteronism . Histopathologically, these animals show early adrenal hyperplasia and reduced KCNJ5 immunostaining, consistent with human disease progression. Cardiovascular manifestations include elevated heart rates and trends toward increased blood pressure, though with notable variability requiring larger sample sizes for definitive characterization . The heterozygous G151R mutation model particularly reflects the more common sporadic form of human primary aldosteronism associated with somatic KCNJ5 mutations, which affects approximately 34% of aldosterone-producing adenomas with higher prevalence in females (49%) than males (19%) . Unlike unsuccessful attempts with rodent models, the porcine systems successfully model disease progression due to similar adrenal KCNJ5 expression patterns between pigs and humans.

What methodological approaches are most effective for phenotyping KCNJ5 mutant pig models?

Effective phenotyping of KCNJ5 mutant pig models requires a comprehensive, multi-system approach. For endocrine assessment, the aldosterone-to-renin ratio measured via liquid chromatography-tandem mass spectrometry provides the most sensitive diagnostic parameter, with samples collected at standardized times (8-10am) after standardized posture and diet to minimize variability . Cardiovascular phenotyping should combine non-invasive tail-cuff oscillometric blood pressure measurements (multiple readings over several days) with more definitive telemetric monitoring for 24-hour profiles. Electrolyte homeostasis analysis should include both plasma and urinary K+, Na+ levels, with 24-hour collections providing more comprehensive data than spot measurements . Adrenal imaging using contrast-enhanced CT scan protocols adapted for porcine anatomy helps identify structural changes. For molecular phenotyping, adrenal biopsy with immunohistochemical characterization using antibodies against KCNJ5 and aldosterone synthase (CYP11B2) confirms altered expression patterns . Functional testing with saline suppression or captopril challenge assesses autonomy of aldosterone production. These methodologies should be sequentially applied at defined age intervals (e.g., 12, 24, and 36 weeks) to capture disease progression.

How can researchers utilize pig KCNJ5 models to test novel therapeutic approaches for primary aldosteronism?

Pig KCNJ5 models offer unique advantages for testing novel primary aldosteronism therapeutics. For pharmacological intervention studies, macrolide antibiotics and their derivatives without antibiotic effects that specifically inhibit mutant KCNJ5 channels represent promising candidates for targeted therapy . Drug administration protocols should include dose-response testing (typically 3-5 dose levels) with both acute (single dose) and chronic (14-28 day) regimens to assess immediate channel blockade and long-term effects on adrenal hyperplasia. Comprehensive efficacy assessment requires monitoring aldosterone levels, ARR, blood pressure, and electrolyte normalization. Pharmacokinetic/pharmacodynamic modeling benefits from the pig's similar body mass and metabolism to humans, allowing more accurate dose translation. For novel therapeutic approaches such as gene therapy or RNA interference targeting mutant KCNJ5, adrenal-targeted delivery systems can be tested using image-guided approaches. The pig model permits repeated sampling and longitudinal follow-up impossible in smaller animals. Importantly, the ability to perform selective venous sampling in pigs, similar to clinical procedures in humans, allows for precise assessment of therapeutic effects on adrenal hormone production.

How do specific KCNJ5 mutations differentially affect channel biophysics and cellular physiology?

KCNJ5 mutations exhibit distinct biophysical and physiological consequences that can be systematically characterized in recombinant systems. The G151R mutation, prevalent in both human aldosterone-producing adenomas and porcine models, fundamentally alters channel selectivity, reducing K+ selectivity while increasing Na+ permeability . This altered ion selectivity leads to membrane depolarization, activating voltage-gated calcium channels and subsequently increasing intracellular Ca2+ concentration, a critical second messenger for aldosterone production. Electrophysiological characterization using whole-cell patch-clamp reveals distinct current-voltage relationships between wild-type and mutant channels, with G151R mutation showing reduced inward rectification and altered reversal potential. At the cellular level, sustained depolarization from mutant KCNJ5 channels triggers calcium-dependent signaling cascades that upregulate steroidogenic enzyme expression, particularly CYP11B2 (aldosterone synthase). Different mutations (G151R vs. L168R) show variable effects on channel trafficking and surface expression, with some mutations causing partial retention in the endoplasmic reticulum. The heterozygous state (KCNJ5G151R/+) exhibits intermediate phenotypes due to the formation of heterotetrameric channels with mixed properties, explaining the dominant nature of these mutations in clinical settings .

What genomic and transcriptomic changes accompany KCNJ5 mutations in adrenal tissue?

Comprehensive genomic and transcriptomic profiling of KCNJ5-mutant adrenal tissues reveals complex molecular landscapes that extend beyond direct channel effects. Transcriptome analysis of aldosterone-producing adenomas with KCNJ5 mutations (both G151R and L168R) shows that, surprisingly, these tumors are indistinguishable from KCNJ5-wild-type tumors at the global transcriptome level based on hierarchical clustering . This suggests that while the initiating mechanisms differ, they converge on similar downstream pathways driving aldosterone production. Nevertheless, focused analysis of calcium-responsive transcription factors reveals subtle differences, with increased expression of NURR1 and ATF3 in KCNJ5-mutant tissues. Pathway analysis highlights upregulation of steroidogenic enzymes including STAR, CYP11A1, and HSD3B2 in addition to CYP11B2. Interestingly, compensatory transcriptional changes occur in other potassium channel genes, with downregulation of KCNJ3 (GIRK1) which normally forms heteromeric channels with KCNJ5. Epigenetic modifications, particularly at steroidogenic enzyme promoters, show altered DNA methylation patterns and histone marks consistent with transcriptional activation. These multi-omics findings suggest that while KCNJ5 mutations may initiate pathology through ion permeability changes, the sustained disease phenotype involves broader transcriptional reprogramming of adrenocortical cells.

What are the current technical limitations in pig KCNJ5 research and potential methodological solutions?

Current technical limitations in pig KCNJ5 research span several domains, each with emerging methodological solutions. For genetic manipulation, mosaicism remains a significant challenge in CRISPR/Cas9-edited pigs, with typical editing efficiencies of 5-6% in fibroblasts prior to somatic cell nuclear transfer . This can be addressed through improved delivery methods such as base editing or prime editing systems, which have demonstrated comparable efficiency (5.19%) but potentially reduced off-target effects . The labor-intensive and costly nature of pig model generation can be mitigated through refinement of embryo transfer protocols and optimization of blastocyst development rates beyond current 12% levels . Phenotypic characterization faces challenges from high intra- and inter-individual variability in blood pressure measurements, necessitating implementation of continuous telemetric monitoring systems adapted for porcine subjects rather than relying solely on tail-cuff methods . For molecular studies, limited availability of pig-specific research reagents can be overcome through development and validation of cross-reactive antibodies and pig-specific transcriptomic platforms. Drug delivery to adrenal tissue presents another challenge, potentially addressable through development of lipid nanoparticle formulations with adrenal tropism. Finally, translating findings between species remains complex due to physiological differences in hormone regulation, requiring careful attention to species-specific reference ranges and potentially development of humanized pig models with additional genetic modifications.

Table 1: Comparative Properties of KCNJ5 Across Species

PropertyPig KCNJ5Human KCNJ5Rodent KCNJ5
Expression in adrenal zona glomerulosaHighHighMinimal
Conductance (pS)~22~19~16
G-protein modulationStrongStrongModerate
Barium sensitivity (IC50, μM)~10~12~30
Na+ permeability (relative to K+)0.010.010.02
Common aliasesKCNJ5, GIRK4KCNJ5, CIR, GIRK4, KATP1, KIR3.4Kcnj5, Girk4

Table 2: Phenotypic Characteristics of KCNJ5G151R/+ Knock-in Pigs Compared to Wild-type Controls

ParameterKnock-in Pigs (KCNJ5G151R/+)Wild-type ControlsSignificance
Aldosterone-to-renin ratio1.17 ± 0.410.48 ± 0.14p < 0.05
Heart rate (bpm)ElevatedNormalp < 0.05
Systolic blood pressure (mmHg)Trend toward elevationNormalNot significant
KCNJ5 immunostainingReducedNormalQualitative
Signs of adrenal hyperplasiaPresentAbsentQualitative

Table 3: Genome Editing Efficiency Comparison for KCNJ5 Modification in Porcine Cells

Editing ApproachEditing EfficiencyBlastocyst RateAdvantagesLimitations
CRISPR/Cas9 with HDR5.46%12%Well-established, efficientOff-target effects, indel formation
Prime Editing (PE)5.19%12%Reduced off-targets, precisionNewer technology, less validated
Base EditingNot reportedNot reportedHighly specific, no DSBsLimited to certain mutation types
SCNT from edited cellsN/A12%Allows full animal generationResource intensive, low efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.