Recombinant Pig G-protein coupled receptor 39 (GPR39)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig GPR39

GPR39 belongs to the rhodopsin-like G-protein coupled receptor (GPCR) family and is evolutionarily conserved across vertebrates. The recombinant pig variant (UniProt ID: B2ZHY2) is a full-length protein (1–456 amino acids) expressed in E. coli with an N-terminal His tag for purification . It serves as a critical tool for investigating GPCR signaling mechanisms, particularly in swine-specific metabolic and neurological studies.

Research Applications

Recombinant pig GPR39 is utilized in:

  • GPCR signaling studies: Investigating ligand-independent constitutive activity via Gαq and Gα12/13 pathways .

  • Zinc and bile acid sensing: Exploring its dual role in Zn²⁺-mediated epithelial repair and bile acid receptor activity .

  • Neurological research: Modulating glycinergic inhibition in spinal cord interneurons, relevant to pain perception .

Production and Purification

The protein is produced in E. coli under optimized conditions:

  • Expression vector: pRK5 or similar systems .

  • Purification: Affinity chromatography using His tag .

  • Purity: >90% by SDS-PAGE .

Functional Insights

  • Zinc sensing: Mediates Zn²⁺-dependent activation of ERK/MAPK and PI3K/AKT pathways, crucial for epithelial repair .

  • Metabolic regulation: Modulates lipolysis and adipose tissue metabolism via hormone-sensitive lipase interactions .

  • Heteroreceptor complexes: Forms dynamic complexes with HTR1A and GALR1, enhancing NF-κB signaling .

Comparative Analysis Across Species

While human GPR39 responds to Zn²⁺ and bile acids, zebrafish orthologs show preferential activation by bile acids (e.g., 3-O-sulfated lithocholic acid) . Pig GPR39’s ligand specificity remains under investigation but is anticipated to align with mammalian zinc-sensing roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our protein products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please let us know, and we will prioritize its development.
Synonyms
GPR39; G-protein coupled receptor 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MASPSRPGNDCSHVIDHSHVPEFEVATWIKITLILLFLVIFVVGILGNSVTIRVTQVLQK KGYLQKEVTDHMVSLACSDILVFLIGMPVEFYSIIWNPLTTPSYTVSCKLHSFLFETCSY ATLLHVLTLSFERYIAICHPFRYKAMSGPCQVKLLIGFVWVTSTLVALPLLFAMGVEYPL VDVPSHRGLSCNRSRNHHSEHPETSNMSVCTNLSSRWTVFQSSIFGAFIIYLVVLVSVAF MCWSMMQALQRSKQGTLAAKGQQLQLRKSESEESRSARRQTIIFLRLIVVTLAICWMPNQ IRRMMAAAKPKQDWTKAYFKAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRSVFAQVLR CRLTLPHANQDKRLRAQAASTMDSARSVHRPLIFLASRSNSSARRTDKVFLSTSQSESEA KPQSKPQLLNHESPESDSVMKPANPATENGIQEHEV
Uniprot No.

Target Background

Function
Zn(2+) acts as an agonist for GPR39. This receptor mediates its effects by associating with G proteins, activating a phosphatidylinositol-calcium second messenger system. Its actions are primarily mediated through G(q)-alpha and G(12)/G(13) proteins. GPR39 is involved in regulating body weight, gastrointestinal motility, hormone secretion, and cell death.
Gene References Into Functions
  1. Research has shown that GPR39 is a transducer of Zn(2+) and promotes proliferation and differentiation of porcine intramuscular preadipocytes through activation of the PI3K/Akt signaling pathway. PMID: 26524639
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the primary signaling pathways activated by GPR39?

GPR39 activates multiple intracellular signaling pathways through various G-protein coupling mechanisms:

  • Gs pathway: Leads to cAMP production

  • Gq pathway: Results in IP1 accumulation

  • G12/13 pathway: Activates SRF-RE-dependent transcription

  • β-arrestin recruitment: Involved in receptor internalization and signaling

Additionally, GPR39 activation by zinc in keratinocytes increases intracellular Ca²⁺ concentration and activates the ERK/MAPK and PI3K/AKT signaling pathways, which are crucial for epithelial repair . In adipose tissue, GPR39 regulates lipolysis and influences the function of lipases, such as hormone-sensitive lipase and adipose triglyceride lipase . GPR39 also plays a role in inhibiting cell death by inducing secretion of cytoprotective factors like pigment epithelium-derived growth factor (PEDF) through GNA13/RHOA/SRE-dependent mechanisms .

How does GPR39 participate in zinc sensing and signaling?

GPR39 functions as a zinc-sensing receptor that can detect changes in extracellular Zn²⁺ concentrations and transduce this signal into various intracellular signaling cascades . Zinc binding to GPR39 initiates conformational changes in the receptor structure, allowing it to couple with G proteins (Gs, Gq, G12/13) and recruit β-arrestin .

This zinc sensing capability enables GPR39 to participate in numerous zinc-dependent physiological processes including glucose homeostasis regulation, gastrointestinal mobility, hormone secretion, and cell death regulation . In keratinocytes, zinc-dependent activation of GPR39 increases intracellular Ca²⁺ and triggers the ERK/MAPK and PI3K/AKT signaling pathways, promoting epithelial repair .

GPR39 also forms dynamic heteroreceptor complexes with other receptors like HTR1A and GALR1, creating signaling diversity in response to zinc. The HTR1A-GPR39 complex shows additive increases in signaling along the serum response element (SRE) and NF-kappa-B pathways, while GALR1 acts as an antagonist blocking SRE .

What expression systems are most effective for producing functional recombinant pig GPR39?

Based on the available data, several expression systems can be used for producing recombinant pig GPR39, each with specific advantages and limitations:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, established protocolsLimited post-translational modifications, potential inclusion bodies
Mammalian cells (HEK293, CHO)Native-like modifications, proper foldingLower yield, higher cost, longer expression time
Insect cells (Sf9, Sf21)Higher yield than mammalian cells, proper foldingIntermediate cost, different glycosylation patterns
Yeast (Pichia pastoris)High yield, eukaryotic processing, cost-effectiveDifferences in glycosylation compared to mammals

What are the optimal purification methods for recombinant pig GPR39?

Purification of His-tagged recombinant pig GPR39 typically follows this protocol:

  • Cell lysis: Solubilize the membrane-bound GPR39 using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS.

  • Immobilized metal affinity chromatography (IMAC):

    • Equilibrate Ni-NTA resin with washing buffer containing detergent

    • Apply clarified cell lysate

    • Wash with increasing imidazole concentrations

    • Elute GPR39 with high-concentration imidazole buffer

  • Size exclusion chromatography (SEC):

    • Further purify to remove aggregates

    • Use buffer containing detergent above critical micelle concentration

  • Quality assessment: Verify purity using SDS-PAGE, aiming for >90% purity .

  • Storage: Store as a lyophilized powder. For reconstitution:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) and aliquot for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

This protocol may require optimization depending on the expression system and intended downstream applications.

How can I verify the proper folding and function of purified GPR39?

Verifying proper folding and function of purified recombinant pig GPR39 is critical for ensuring reliable experimental results. Several complementary approaches should be employed:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

    • Thermal shift assays to assess stability

  • Ligand binding assays:

    • Zinc binding assays using radioactive ⁶⁵Zn or fluorescent zinc indicators

    • Binding studies with known GPR39 modulators like GPR39-C3

  • Functional assays:

    • Reconstitution into proteoliposomes or nanodiscs

    • G protein coupling assays using purified G proteins

    • Cell-based verification through transfection into GPR39-null cells

  • Pathway-specific activation:

    • cAMP production (Gs pathway)

    • IP1 accumulation (Gq pathway)

    • SRF-RE-dependent transcription (G12/13 pathway)

    • β-arrestin recruitment

Functional GPR39 should demonstrate zinc responsiveness and activate multiple signaling pathways in a manner consistent with the native receptor. Additionally, it should undergo desensitization upon repeated stimulation with agonists like GPR39-C3 .

What cell-based assays can measure GPR39 activation in vitro?

Based on published research, several cell-based assays have been successfully used to measure GPR39 activation:

  • cAMP production assays:

    • Measure Gs pathway activation

    • Allow for dose-response studies with agonists like zinc or GPR39-C3

  • IP1 accumulation assays:

    • Measure Gq pathway activation

    • Typically use HTRF-based detection methods

  • SRF-RE-dependent transcription assays:

    • Measure G12/13 pathway activation

    • Use reporter gene constructs with SRF-responsive elements

  • β-arrestin recruitment assays:

    • Measure receptor internalization and β-arrestin signaling

    • Can use BRET or enzyme complementation techniques

    • Useful for studying biased ligands like GSB-118

  • Receptor internalization assays:

    • Use GFP-tagged GPR39 to track receptor localization

    • Confocal microscopy for visualization

  • Calcium mobilization assays:

    • Measure intracellular Ca²⁺ increases upon Gq activation

    • Use fluorescent Ca²⁺ indicators

For desensitization studies, sequential stimulation protocols can be employed, where cells are challenged with an agonist, washed, and then restimulated to assess the loss of responsiveness over time .

How can I study GPR39 desensitization mechanisms?

GPR39 undergoes functional desensitization upon activation with specific agonists. The following methodological approaches can be used to study this process:

  • Sequential stimulation protocol:

    • Treat GPR39-expressing cells with an agonist (e.g., GPR39-C3)

    • Wash out the agonist

    • Challenge with a second dose of the same agonist

    • Measure the response (e.g., cAMP production) compared to the first stimulation

    • This allows for dose- and time-dependent analysis of desensitization

  • Pharmacological inhibition studies:

    • Use specific pathway inhibitors to determine signaling components involved in desensitization

    • The Rho kinase (ROCK) inhibitor Y-27632 blocks GPR39 desensitization

    • Testing inhibitors of Gq, Gs pathways, or β-arrestin recruitment can help determine pathway specificity

  • Receptor localization assays:

    • Use GFP-tagged GPR39 to monitor receptor internalization

    • This internalization is inhibited by Y-27632, suggesting ROCK activation is critical for GPR39 internalization and desensitization

  • Biased ligand comparison:

    • Compare desensitization profiles of different agonists

    • GSB-118, a biased GPR39 positive allosteric modulator that activates cAMP responses and β-arrestin recruitment but not SRF-RE-dependent transcription, does not induce desensitization

These approaches reveal that GPR39 desensitization involves a unique ROCK-dependent mechanism leading to receptor internalization, which is distinct from the typical GRK/β-arrestin pathway observed for many GPCRs .

What methods can reveal GPR39's interactions with other proteins?

GPR39 forms functional complexes with various proteins, including heteroreceptor complexes with HTR1A and GALR1 and interactions with glycine receptors (GlyRs) . Investigating these interactions requires specialized techniques:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against GPR39 (such as the anti-GPCR GPR39 antibody)

    • Precipitate receptor complexes from cell lysates

    • Detect interacting partners by Western blot

    • Requires careful optimization of detergent conditions

  • Proximity-based techniques:

    • Resonance energy transfer methods (FRET/BRET)

    • Proximity ligation assay (PLA) for detecting interactions in fixed cells or tissues

  • Functional complementation assays:

    • Split reporter protein systems (e.g., split luciferase)

    • Signal generated only when receptors interact

  • Functional analysis:

    • For heteroreceptor complexes like GPR39-HTR1A and GPR39-GALR1, measure pathway activations in cells expressing individual receptors versus co-expressing both receptors

    • HTR1A-GPR39 shows additive increases in SRE and NF-kappa-B signaling, while GALR1 acts as an antagonist blocking SRE

    • For GPR39-GlyR interactions, electrophysiological recordings can assess how GPR39 modulation affects glycinergic currents

These methods provide complementary insights into the molecular and functional aspects of GPR39's protein-protein interactions, which are essential for understanding its diverse physiological roles.

How does GPR39 contribute to pain modulation?

Recent research has revealed GPR39's significant role in pain processing, particularly in the context of mechanical pain:

  • Spinal cord localization and function:

    • GPR39 is expressed in somatostatin-positive (SOM+) interneurons

    • These are "a mechanosensitive subpopulation that is critical for the conveyance of mechanical pain"

    • GPR39 helps maintain glycinergic transmission in these neurons

  • Molecular mechanisms:

    • GPR39 "complexed specifically with inhibitory glycine receptors (GlyRs)"

    • This interaction maintains glycinergic inhibition

    • Notably, this occurs "in a manner independent of G protein signalings"

    • This represents a non-canonical function of GPR39 distinct from its traditional G protein-coupled signaling

  • Functional consequences of GPR39 modulation:

    • "Targeted knockdown of GPR39 in SOM+ interneurons reduced the glycinergic inhibition"

    • This facilitated "excitatory output from SOM+ interneurons to spinoparabrachial neurons"

    • These spinoparabrachial neurons engage "superspinal neural circuits encoding both the sensory discriminative and affective motivational domains of pain experience"

  • Therapeutic potential:

    • "Pharmacological activation of GPR39 or augmenting GPR39 interaction with GlyRs at the spinal level effectively alleviated the sensory and affective pain induced by complete Freund's adjuvant"

    • This positions GPR39 as "a promising therapeutic target for the treatment of inflammatory mechanical pain"

These findings highlight GPR39 as a unique regulatory component in pain processing, with a mechanism distinct from traditional analgesic targets .

What role does GPR39 play in metabolic regulation?

GPR39 participates in several aspects of metabolic regulation, suggesting potential implications in metabolic disorders:

  • Glucose homeostasis:

    • GPR39 participates in "glucose homeostasis regulation"

    • This suggests potential roles in diabetes and insulin resistance

    • Research approaches could include:

      • GPR39 expression analysis in pancreatic islets and insulin-responsive tissues

      • Effects of GPR39 activation on insulin secretion and sensitivity

      • Glucose tolerance tests in GPR39 knockout models

  • Adipose tissue metabolism:

    • GPR39 "regulates adipose tissue metabolism, especially lipolysis, and regulates the function of lipases"

    • This indicates potential roles in obesity and dyslipidemia

    • Research could examine:

      • Adipocyte-specific deletion or overexpression of GPR39

      • Effects on fat mass and distribution

      • Analysis of lipid profiles and adipokine secretion

  • Gastrointestinal functions:

    • GPR39 regulates "gastrointestinal mobility"

    • This suggests roles in:

      • Nutrient absorption and sensing

      • Gut hormone secretion

      • Gut-brain communication affecting appetite and satiety

  • Zinc metabolism:

    • As a zinc-sensing receptor, GPR39 may link zinc status to metabolic regulation

    • Zinc deficiency is associated with diabetes and obesity

    • Research could explore how zinc availability affects GPR39-mediated metabolic processes

  • Stress protection:

    • GPR39 "protects against oxidative, endoplasmic reticulum and mitochondrial stress"

    • These stress pathways are implicated in metabolic disorders

    • GPR39 activation might potentially alleviate cellular stress in metabolic disease models

These diverse metabolic functions position GPR39 as a potential therapeutic target for metabolic disorders, with possible applications in developing selective agonists or biased ligands that activate beneficial pathways.

How can I optimize zinc conditions for GPR39 functional studies?

As a zinc-sensing receptor, GPR39 functionality is highly dependent on appropriate zinc conditions. Optimizing these conditions is critical for reliable experimental outcomes:

  • Zinc concentration determination:

    • Establish dose-response curves for zinc activation of GPR39

    • Typical effective concentrations range from low micromolar to tens of micromolar

    • Consider using zinc buffers (mixtures of zinc and chelators) to maintain free zinc at defined levels

  • Zinc contamination control:

    • Standard media and buffers contain variable zinc concentrations

    • Use zinc-free water and reagents where possible

    • Consider removing background zinc with selective chelators before experimental zinc addition

    • Measure background zinc levels using sensitive analytical methods (ICP-MS, zinc-selective fluorophores)

  • Zinc delivery methods:

    • For acute activation: Direct addition of zinc salts (ZnCl₂, ZnSO₄)

    • For controlled release: Zinc ionophores like pyrithione

    • For in vivo studies: Consider zinc supplementation protocols or local zinc delivery methods

  • Physiological relevance considerations:

    • Total serum zinc is typically 10-20 μM, but most is bound to proteins

    • Free zinc concentrations are in the nanomolar to low micromolar range

    • Zinc concentrations can fluctuate significantly in microenvironments

    • Design zinc conditions to reflect the physiological context being studied

  • Synergy with other modulators:

    • Consider testing zinc in combination with positive allosteric modulators like GPR39-C3

    • Investigate potential competition or synergy with other divalent cations

  • Control experiments:

    • Include zinc chelators (TPEN, DTPA) as negative controls

    • Use GPR39 knockout or knockdown systems to confirm specificity

    • Consider the effect of zinc on other zinc-sensitive cellular processes

By carefully optimizing and controlling zinc conditions, researchers can ensure more consistent and physiologically relevant results in GPR39 functional studies.

Why might recombinant GPR39 show reduced functionality in certain experimental systems?

Several factors can contribute to reduced functionality of recombinant pig GPR39 in experimental systems:

  • Protein folding issues:

    • GPCRs require specific conditions for proper folding

    • Expression in prokaryotic systems (like E. coli) may result in misfolded protein

    • Consider expression in eukaryotic systems or in vitro refolding protocols

  • Post-translational modifications:

    • GPR39 may require specific modifications for full functionality

    • Human GPR39 is phosphorylated on serine and threonine residues in the C-terminal region

    • Different expression systems provide different modification patterns

  • Lipid environment:

    • GPCRs function within a lipid bilayer

    • Specific lipid compositions may be required for optimal function

    • Consider reconstitution in appropriate lipid mixtures or testing different detergents

  • Zinc availability:

    • As a zinc-sensing receptor, GPR39 functionality depends on appropriate zinc concentrations

    • Buffer compositions may chelate zinc or contain interfering contaminants

  • Lack of interaction partners:

    • GPR39 forms complexes with other proteins like glycine receptors

    • These interactions may be necessary for certain functions

  • Desensitization mechanisms:

    • GPR39 undergoes desensitization via a ROCK-dependent mechanism

    • This might affect observed responses in prolonged experiments

    • Consider using ROCK inhibitors like Y-27632

  • Storage and handling issues:

    • Avoid repeated freeze-thaw cycles

    • Follow recommended reconstitution protocols (adding 5-50% glycerol, storing at appropriate temperatures)

A systematic approach to troubleshooting would involve testing these potential factors methodically, starting with protein quality assessment and moving to more complex functional analyses.

What strategies can improve experiments studying GPR39-regulated signaling pathways?

To improve the reliability and reproducibility of experiments studying GPR39-regulated signaling pathways, consider these methodological strategies:

  • Control receptor expression:

    • Quantify GPR39 expression levels between experiments

    • Use inducible expression systems to standardize receptor levels

    • Create stable cell lines to minimize variation

  • Address desensitization:

    • Account for ROCK-dependent desensitization in experimental design

    • Consider pre-treatment with ROCK inhibitor Y-27632 when appropriate

    • Standardize timing between stimulations

  • Optimize zinc conditions:

    • Control and measure zinc concentrations

    • Account for zinc in media and buffers

    • Use zinc chelators as controls

    • Consider zinc buffering systems for precise free zinc control

  • Investigate multiple pathways:

    • GPR39 activates multiple signaling pathways (Gs, Gq, G12/13, β-arrestin)

    • Measure several downstream readouts in parallel

    • Consider pathway crosstalk in data interpretation

  • Account for heteroreceptor complexes:

    • Characterize expression of potential partner receptors (HTR1A, GALR1)

    • Consider how these interactions affect signaling outcomes

    • Design experiments to investigate complex-specific signaling

  • Design time-course experiments:

    • Different pathways have different activation kinetics

    • Desensitization occurs over time

    • Plot complete time courses rather than single timepoints

  • Consider non-canonical functions:

    • Include assays for G protein-independent functions

    • For spinal neurons, assess GPR39 regulation of glycine receptors

  • Use biased ligands as tools:

    • Compare responses to different GPR39 ligands

    • GSB-118 activates cAMP responses and β-arrestin recruitment but not SRF-RE-dependent transcription

    • This helps dissect pathway-specific responses

These strategies will help generate more consistent and interpretable results in GPR39 signaling studies, enabling more reliable translation to physiological and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.