Recombinant Pig Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Production Methodology

Recombinant Pig GJA1 is produced via prokaryotic expression systems, followed by affinity chromatography using nickel-NTA for His-tag purification . Key parameters:

  • Storage: Lyophilized at -80°C in PBS with stabilizers (e.g., trehalose, DTT) .

  • Stability: 12-month shelf life under recommended conditions .

Research Applications

  • Biomarker Analysis: Quantification in serum, plasma, and tissue homogenates using ELISA (detection range: 78–5,000 pg/mL; sensitivity: 36 pg/mL) .

  • Functional Studies: Role in cardiac contraction, mitochondrial dynamics, and oxidative stress response .

  • Therapeutic Development: Investigating GJA1-20k’s protective effects against ischemia-reperfusion injury .

Mitochondrial Protection via Non-Canonical Fission

  • Mechanism: GJA1-20k induces actin polymerization at mitochondrial constriction sites, triggering fission independent of DRP1 .

  • Outcome: Smaller mitochondria exhibit reduced ROS production, mitigating ischemia-reperfusion injury in cardiac tissue .

  • Experimental Models: Validated in HEK293 cells, neonatal cardiomyocytes, and heterozygous Gja1 M213L/WT mice .

Cardiac Pathophysiology

  • Loss-of-Function: Reduced GJA1-20k expression in mice leads to enlarged mitochondria, increased ROS, and near-total cardiac infarction post-ischemia .

  • Therapeutic Potential: AAV9-mediated GJA1-20k overexpression reduces mitochondrial respiration, protecting against myocardial damage .

Table 3: Recombinant GJA1 Variants

OriginSegmentApplicationPurity
PigAA 180–382SDS-PAGE, Western blot>85%
HumanAA 244–382Immunogen, positive control>80%
MouseAA 180–382Functional assays>97%

Challenges and Future Directions

  • Technical Limitations: Sensitivity to freeze-thaw cycles; requires glycerol stabilization .

  • Unanswered Questions: Role of GJA1-20k in non-cardiac tissues and its interaction with canonical fission machinery .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is preferred, please communicate with us beforehand as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is defined during production. If you have a preferred tag type, please inform us and we will prioritize developing it for your order.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-382
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYAFFKGVKDRVK GKSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLDAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junction protein that acts as a regulator of bladder capacity. A gap junction comprises a cluster of closely packed pairs of transmembrane channels, the connexons, through which low molecular weight materials diffuse from one cell to an adjacent cell. It may play a crucial role in the physiology of hearing by participating in potassium recycling to the cochlear endolymph. It serves as a negative regulator of bladder functional capacity by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and triggering contraction. It may contribute to cell growth inhibition by regulating NOV expression and localization. It plays an essential role in gap junction communication within the ventricles.
Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What is Gap Junction Alpha-1 Protein and what is its primary function?

Gap Junction Alpha-1 Protein (GJA1), also known as Connexin 43 (Cx43), is a 43 kDa protein that serves as a major component of gap junctions. These gap junctions form arrays of intercellular channels that provide pathways for the diffusion of low molecular weight materials between adjacent cells. GJA1 plays a crucial role in the synchronized contraction of the heart and in embryonic development. It facilitates direct intercellular communication, which is essential for coordinated cellular activities in various tissues. Mutations in the GJA1 gene have been associated with oculodentodigital dysplasia and heart malformations, highlighting its physiological importance . The protein is highly conserved across species, making pig GJA1 a valuable research model for understanding human gap junction biology.

What expression systems are most effective for producing functional recombinant pig GJA1?

For producing functional recombinant pig GJA1, mammalian expression systems generally yield the most biologically active protein due to their ability to perform appropriate post-translational modifications. HEK293 cells are particularly effective as they provide the necessary cellular machinery for proper protein folding and oligomerization of connexins. For higher yield production, insect cell expression systems (such as Sf9 or High Five cells) can be utilized, although careful validation of protein functionality is necessary. E. coli-based systems, while offering cost advantages and simplicity, often struggle with producing properly folded transmembrane proteins like GJA1, which can affect functionality. When selecting an expression system, researchers should consider the specific experimental requirements, including whether native post-translational modifications are essential for the intended application . Tag selection (His, Myc, Fc, etc.) should also be considered carefully, as C-terminal tags may interfere with regulatory interactions while N-terminal tags could affect channel assembly.

What are the most reliable methods for detecting and quantifying recombinant pig GJA1 in experimental samples?

Multiple complementary approaches are recommended for reliable detection and quantification of recombinant pig GJA1. Western blotting using specific antibodies represents the gold standard for quantitative analysis, with recommended dilutions ranging from 1:5000 to 1:50000 depending on the antibody and sample type. Immunohistochemistry and immunofluorescence provide spatial information on GJA1 distribution, with optimal dilutions typically between 1:1000-1:4000 for IHC and 1:50-1:500 for IF applications . When performing these analyses, proper controls are essential, including positive controls from tissues known to express high levels of GJA1 (heart tissue is ideal). For mRNA quantification, qRT-PCR with validated primers targeting conserved regions of the GJA1 transcript provides complementary data to protein-level measurements. Flow cytometry can also be employed for cell-surface GJA1 quantification in intact cells. Each method has specific advantages, and combining multiple approaches provides the most robust experimental validation.

How can researchers effectively transfect cells with recombinant pig GJA1 constructs to ensure proper expression and localization?

Successful transfection of cells with recombinant pig GJA1 constructs requires optimization of several parameters. Lipid-based transfection reagents often yield good results with mammalian cell lines, particularly when using codon-optimized GJA1 sequences. For primary cells or hard-to-transfect lines, electroporation or viral delivery systems show higher efficiency. When designing expression constructs, researchers should consider including trafficking signals that ensure proper membrane localization. Following transfection, a 24-48 hour expression period is typically optimal before performing functional assays. Confirmation of proper localization requires immunofluorescence microscopy to verify membrane trafficking and gap junction plaque formation at cell-cell contacts. To verify channel functionality post-transfection, dye transfer assays using low molecular weight fluorescent tracers such as Lucifer yellow can be employed. For in vivo applications, such as in animal models, lentiviral vectors have shown efficacy for GJA1 delivery, as demonstrated in studies examining diabetic bladder dysfunction .

How does GJA1 interact with the Rab11-Rab8 ciliary trafficking pathway, and what methodologies best elucidate these interactions?

GJA1 interacts with the Rab11-Rab8 ciliary trafficking pathway, playing a crucial role in regulating ciliogenesis. Research has shown that GJA1 depletion causes mislocalization of Rab11, a key regulator in ciliary development. To study these interactions effectively, co-immunoprecipitation (co-IP) assays represent the primary methodology, as they have successfully demonstrated physical interaction between GJA1 and Rab11 . For advanced spatial analysis, super-resolution microscopy techniques such as STORM or PALM provide nanoscale visualization of protein co-localization. Proximity ligation assays offer another approach to confirm protein-protein interactions in situ with high sensitivity. To establish functional relationships, researchers should implement Rab11 or Rab8 knockdown/knockout experiments followed by assessment of GJA1 localization and function. Conversely, examining how GJA1 depletion affects Rab protein dynamics using fluorescently tagged Rab constructs can provide valuable insights. Live-cell imaging with dual-color labeling facilitates real-time observation of trafficking dynamics. For comprehensive pathway analysis, combining these approaches with proteomics methods helps identify additional components in the GJA1-Rab signaling axis.

What is the role of recombinant pig GJA1 in ciliary formation and maintenance, and how can this be experimentally investigated?

Recombinant pig GJA1 plays a critical role in both the formation and maintenance of cellular cilia. GJA1 depletion studies have demonstrated malformation of both primary and motile cilia, with GJA1 localizing to motile ciliary axonemes or pericentriolar regions beneath primary cilia . To investigate this experimentally, researchers should employ a multi-faceted approach. Immunofluorescence microscopy using acetylated tubulin antibodies allows quantification of ciliary length, number, and morphology in GJA1-manipulated cells. For dynamic studies, live imaging of ciliary formation using fluorescently tagged basal body markers (such as centrin) alongside GJA1 provides temporal insights. Scanning and transmission electron microscopy offer ultrastructural analysis of ciliary defects. For mechanistic investigations, examining the effect of GJA1 on CP110 removal from mother centrioles is particularly informative, as this represents a critical step in ciliogenesis that is significantly reduced by GJA1 depletion . Experimental models should include both in vitro cell systems and in vivo models such as Xenopus laevis embryonic multiciliated cells, which provide excellent visualization of ciliary processes. Domain-specific mutations in GJA1, particularly the Δ234-243 deletion in the putative tubulin-binding sequence, can help delineate which portions of the protein are essential for ciliary regulation.

How does phosphorylation state affect recombinant pig GJA1 function, and what techniques reveal these regulatory mechanisms?

Phosphorylation represents a primary regulatory mechanism for GJA1 function, with multiple phosphorylation sites in the C-terminal domain modulating channel opening, protein trafficking, and interactions with binding partners. To investigate these regulatory effects experimentally, researchers should employ site-directed mutagenesis to create phosphomimetic (S→D/E) or phospho-null (S→A) variants at key regulatory residues. Patch-clamp electrophysiology provides direct measurement of how these modifications affect channel conductance. For large-scale phosphorylation analysis, mass spectrometry following immunoprecipitation of GJA1 under different physiological conditions (such as hypoxia, mechanical stress, or growth factor stimulation) helps identify condition-specific phosphorylation patterns. Phospho-specific antibodies can track individual modification sites in cell-based assays. For examining the kinase pathways responsible for GJA1 phosphorylation, selective kinase inhibitors combined with phosphorylation-state analysis reveal regulatory enzymes. Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling helps identify proteins that interact with GJA1 in a phosphorylation-dependent manner. These approaches collectively provide a comprehensive understanding of how phosphorylation dynamics regulate recombinant pig GJA1 function in various cellular contexts.

How effective is recombinant GJA1 lentivirus in treating diabetic bladder dysfunction, and what parameters determine successful therapeutic outcomes?

Recombinant GJA1 lentivirus shows promising therapeutic potential for treating diabetic bladder dysfunction. In guinea pig models of diabetic cystopathy, transurethral infusion of GJA1 recombinant lentivirus significantly increased the expression levels of connexin 43 protein and mRNA compared to control groups . Critical parameters determining successful therapeutic outcomes include: (1) Delivery method - transurethral infusion has proven effective in animal models, providing direct access to detrusor muscle cells; (2) Dosage optimization - studies indicate 0.2 mL of GJA1 recombinant lentivirus provides therapeutic effects; (3) Treatment timing - initiating therapy after confirmed urodynamic abnormalities but before irreversible tissue damage occurs; and (4) Expression durability - therapeutic effects should be monitored across multiple timepoints (2, 7, 14, and 28 days) to establish duration of expression and effect . Assessment of therapeutic efficacy should include both molecular markers (connexin 43 protein and mRNA levels via western blot and qRT-PCR) and functional outcomes (urodynamic parameters). Immunohistochemical staining provides valuable information on the distribution pattern of restored connexin 43 expression in bladder tissues, which correlates with functional improvement.

What experimental approaches best demonstrate GJA1's role in cardiac conduction, and how can recombinant pig GJA1 advance cardiac disease models?

GJA1 (Connexin 43) plays a critical role in cardiac conduction, and multiple experimental approaches effectively demonstrate this function. Optical mapping using voltage-sensitive dyes provides spatial and temporal visualization of cardiac conduction patterns in GJA1-manipulated tissues. Multi-electrode array recordings offer quantitative measurement of conduction velocity and arrhythmia susceptibility. For cellular-level studies, patch-clamp electrophysiology directly measures gap junctional conductance between cardiomyocytes. In vivo electrocardiography in animal models with cardiac-specific GJA1 manipulation reveals functional consequences at the whole-heart level. Recombinant pig GJA1 advances cardiac disease models through several mechanisms: (1) As a research tool for understanding species-specific aspects of cardiac conduction; (2) In cell replacement therapies, where cardiomyocytes with optimized GJA1 expression can improve electrical coupling after transplantation; (3) In gene therapy approaches targeting regions with reduced GJA1 expression in heart disease; and (4) For creation of "humanized" large animal models that better recapitulate human cardiac electrophysiology. When studying GJA1 in cardiac models, researchers should consider both expression level and subcellular distribution, as lateralization away from intercalated discs often precedes conduction abnormalities in pathological states.

How can researchers use dominant-negative mutants of GJA1 to model human genetic disorders, and what experimental considerations are most important?

Dominant-negative mutants of GJA1 provide powerful tools for modeling human genetic disorders associated with gap junction dysfunction. Three particularly useful mutants include: T154A (mimics closed-channel status without inhibiting gap junction formation), Δ130-136 (seven-amino acid deletion in the intracellular loop that blocks gap junction permeability), and Δ234-243 (deletion in the tubulin-binding sequence unique to GJA1) . When employing these mutants, critical experimental considerations include: (1) Expression level control - dominant-negative effects depend on expression ratio to endogenous protein, requiring titration experiments to establish optimal conditions; (2) Cellular context - effects may vary between cell types due to differential expression of other connexin family members that could compensate for GJA1 dysfunction; (3) Functional validation - confirmation of dominant-negative effects through dye transfer assays, electrophysiological recordings, or other functional readouts is essential; and (4) Phenotypic analysis - comprehensive characterization should include both molecular (protein localization, complex formation) and functional (tissue-specific) outcomes. For in vivo applications, conditional expression systems offer advantages by allowing temporal control of mutant expression, preventing developmental compensation. When modeling specific human disorders like oculodentodigital dysplasia, researchers should prioritize mutants that precisely mimic the human mutation of interest rather than using general dominant-negative constructs.

What are the common pitfalls when working with recombinant pig GJA1 in experimental systems, and how can they be addressed?

Working with recombinant pig GJA1 presents several common challenges that researchers should anticipate. Protein aggregation during expression and purification frequently occurs due to GJA1's multiple transmembrane domains. This can be mitigated by optimizing detergent conditions (mild non-ionic detergents like DDM or CHAPS often work well) and avoiding freeze-thaw cycles. Expression level variability between experiments represents another common issue, which can be addressed through consistent transfection protocols and inclusion of internal normalization controls. Antibody cross-reactivity with other connexin family members can confound results; researchers should validate antibody specificity against knockout controls and consider using epitope tags when specific antibodies are unavailable. For functional studies, endogenous GJA1 expression in many cell lines can mask recombinant protein effects, necessitating knockdown/knockout of endogenous GJA1 before introducing recombinant variants. Post-translational modification heterogeneity can also complicate interpretation; phospho-specific antibodies or mass spectrometry can help characterize the modification state. When studying gap junction formation, cell culture density is critical, as subconfluent cultures may not form adequate cell-cell contacts for junction assembly, while overconfluent cultures can downregulate GJA1 expression .

How can researchers distinguish between direct GJA1 effects and secondary consequences in experimental systems?

Distinguishing direct GJA1 effects from secondary consequences requires sophisticated experimental design. Acute interventions using techniques like optogenetics or rapidly-inducible expression systems help identify immediate GJA1 effects before secondary adaptations occur. Channel-dead mutations (like T154A) that maintain protein-protein interactions while eliminating channel function can differentiate between communication-dependent and scaffolding functions of GJA1 . Domain-specific mutations targeting particular protein interaction motifs can pinpoint which GJA1 functions are responsible for specific phenotypes. Complementary approaches using hemichannel blockers (such as carbenoxolone or mimetic peptides) that specifically target channel function provide pharmacological validation. Rescue experiments represent a gold standard approach - if re-expression of wild-type GJA1 reverses a knockout phenotype while a channel-dead mutant does not, the effect likely depends on channel function. Temporal analysis tracking molecular and cellular changes at multiple timepoints after GJA1 manipulation helps establish cause-effect relationships. For systems-level understanding, combining these approaches with transcriptomics or proteomics can identify the cascade of events following GJA1 manipulation, helping separate primary from secondary effects.

What strategies overcome the challenges of studying GJA1 trafficking and localization in complex tissues?

Studying GJA1 trafficking and localization in complex tissues presents significant technical challenges requiring specialized approaches. Tissue clearing techniques (such as CLARITY, CUBIC, or iDISCO) combined with immunostaining enable deep tissue imaging while preserving spatial relationships. For improved resolution, expansion microscopy physically enlarges tissues, allowing standard confocal microscopes to achieve super-resolution imaging of GJA1 localization. Live tissue imaging using organotypic slice cultures labeled with fluorescently-tagged GJA1 permits real-time visualization of trafficking dynamics. To track newly synthesized protein specifically, researchers can employ pulse-chase approaches with metabolic labeling or photoconvertible fluorescent tags. For discriminating between intracellular and surface-localized GJA1, membrane-impermeable biotinylation reagents selectively label surface proteins. Single-molecule tracking in tissue contexts has become feasible with techniques like sptPALM, revealing GJA1 movement with nanometer precision. When studying GJA1 interaction with structures like cilia, multi-color imaging with structure-specific markers (such as acetylated tubulin for ciliary axonemes) is essential for establishing spatial relationships . For quantitative analysis of localization patterns, custom image analysis algorithms can extract parameters like gap junction plaque size, density, and subcellular distribution from complex tissue images.

How might CRISPR-Cas9 genome editing advance our understanding of pig GJA1 function in translational models?

CRISPR-Cas9 genome editing offers transformative potential for understanding pig GJA1 function in translational models. Creation of precisely engineered knock-in pigs carrying human disease-associated GJA1 mutations would provide physiologically relevant large animal models for conditions like oculodentodigital dysplasia or certain cardiac conduction disorders. Tissue-specific conditional knockout models using Cre-loxP systems with CRISPR-engineered animals enable assessment of GJA1 function in specific contexts while avoiding developmental compensation or embryonic lethality. Base editing or prime editing approaches allow introduction of specific point mutations without double-strand breaks, facilitating creation of subtle regulatory mutants affecting phosphorylation sites. For mechanistic studies, CRISPR interference (CRISPRi) or activation (CRISPRa) systems provide temporal control over GJA1 expression, allowing researchers to distinguish between developmental versus acute requirements for the protein. Multiplexed editing targeting GJA1 alongside interacting proteins such as components of the Rab11-Rab8 pathway would elucidate functional relationships in intact physiological contexts . These genome editing approaches, combined with physiological assessments in pig models, bridge the gap between cellular studies and human applications, accelerating translational research on GJA1-related disorders.

What role might artificial intelligence and computational modeling play in predicting GJA1 structure-function relationships?

Artificial intelligence and computational modeling are increasingly valuable for predicting GJA1 structure-function relationships. Deep learning approaches now enable accurate prediction of protein structures, including transmembrane proteins like GJA1, with AlphaFold and similar tools providing atomic-level models that can reveal conformational changes associated with channel opening, closing, and regulation. Molecular dynamics simulations using these structures can predict how mutations affect channel conductance, ion selectivity, and stability. Network analysis algorithms help identify critical residues at the interface between connexin monomers that are essential for oligomerization. For functional prediction, machine learning models trained on experimental data can forecast how specific mutations or post-translational modifications might affect GJA1 channel properties. Systems biology approaches integrating multi-omics data help position GJA1 within broader signaling networks, predicting consequences of GJA1 manipulation across cellular pathways. These computational approaches are particularly valuable for screening large numbers of potential mutations or drug candidates before experimental validation. As these technologies advance, integration of structural predictions with functional data and phenotypic outcomes will create increasingly accurate models of GJA1 biology, accelerating discovery while reducing reliance on time-consuming experimental approaches.

How can single-cell technologies enhance our understanding of cell-specific GJA1 functions in heterogeneous tissues?

Single-cell technologies offer unprecedented insights into cell-specific GJA1 functions within heterogeneous tissues. Single-cell RNA sequencing (scRNA-seq) reveals cell-type-specific expression patterns of GJA1 and co-expressed genes, identifying potential regulatory relationships and cell populations where GJA1 plays critical roles. Spatial transcriptomics maintains tissue context while providing transcriptional information, revealing how GJA1 expression varies across microanatomical regions. For protein-level analysis, mass cytometry (CyTOF) or imaging mass cytometry enables simultaneous measurement of GJA1 alongside dozens of other proteins at single-cell resolution. Single-cell ATAC-seq identifies cell-type-specific regulatory elements controlling GJA1 expression, while single-cell Hi-C maps three-dimensional chromatin organization affecting GJA1 regulation. These approaches are particularly valuable for understanding GJA1's role in complex tissues like the heart, brain, or bladder, where multiple cell types may depend on GJA1 for different functions . For functional studies, patch-seq combines electrophysiological recording with transcriptional profiling of the same cell, directly linking GJA1 channel activity to gene expression profiles. Integration of these single-cell datasets through computational approaches creates comprehensive maps of GJA1 function across cell types, developmental stages, and disease states, revealing previously inaccessible biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.