Recombinant Pig Glycophorin-A (GYPA)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant Pig GYPA is typically produced via heterologous expression systems optimized for eukaryotic post-translational modifications:

SystemAdvantagesLimitations
Yeast (e.g., S. cerevisiae)Cost-effective, glycosylation capabilityLimited to N-linked glycans
Mammalian CellsNative-like O-linked glycosylationHigh cost, low yield
E. coliRapid production, high yieldNo glycosylation

Commercial preparations often employ yeast systems for balance between cost and functionality . For example, a recombinant Pig GYPA (ABIN1472699) expressed in yeast achieves >90% purity, suitable for ELISA and binding assays .

Functional Roles and Biological Significance

While human GYPA is well-characterized as a receptor for pathogens (e.g., influenza virus, Plasmodium falciparum) and a mediator of erythrocyte membrane stability , pig-specific roles remain understudied. Key inferred functions include:

  • Membrane Structure: Anchors erythrocyte proteins (e.g., band 3/SLC4A1) via transmembrane interactions .

  • Pathogen Binding: Potential receptor for porcine pathogens, analogous to human GYPA’s role in hepatitis A virus entry .

  • Blood Group Antigen: Defines MN blood group antigens in pigs, critical for transfusion medicine .

Applications in Research and Diagnostics

Recombinant Pig GYPA is utilized in:

Recombinant GYPA serves as a substrate for:

  • Antigenic Studies: Mapping epitopes for antibody development .

  • Pathogen Receptor Modeling: Identifying targets for antiviral therapies in swine .

Data Tables

Recombinant Pig GYPA is a versatile reagent in veterinary research, offering insights into erythrocyte biology, pathogen interactions, and hematological disorders. While current applications focus on diagnostics (e.g., ELISA kits), further studies are needed to elucidate species-specific functions. Advancements in expression systems and glycoengineering will enhance its utility in therapeutic development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GYPA; Glycophorin-A; CD antigen CD235a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
TETPVTGEQGSATPGNVSNATVTAGKPSATSPGVMTIKNTTAVVQKETGVPESYHQDFSHAEITGIIFAVMAGLLLIIFLIAYLIRRMIKKPLPVPKPQDSPDIGTENTADPSELQDTEDPPLTSVEIETPAS
Uniprot No.

Target Background

Function

Glycophorin A is the major intrinsic membrane sialoglycoprotein of erythrocytes. It plays a crucial role in SLC4A1 function and is essential for high SLC4A1 activity. It may also be involved in SLC4A1 translocation to the plasma membrane.

Protein Families
Glycophorin-A family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is Pig Glycophorin-A (GYPA) and how does it compare to its human counterpart?

Pig Glycophorin-A is a sialoglycoprotein found in porcine erythrocyte membranes, functionally similar to human GYPA. Human GYPA is a 150-amino acid membrane protein bearing antigenic determinants for MN and Ss blood groups . While sequence differences exist between species, the general architecture likely includes a heavily glycosylated extracellular domain, single transmembrane segment, and short cytoplasmic tail.

For comparative studies, researchers should perform sequence alignment between human and pig GYPA to identify conserved regions, particularly around functional domains. Human GYPA contains multiple O-linked and N-linked glycosylation sites that are critical for its biological function; similar sites would be expected in the porcine variant with species-specific modifications .

What expression systems are most effective for recombinant pig GYPA production?

Selection of an appropriate expression system depends on research objectives:

Expression SystemAdvantagesLimitationsBest For
Mammalian (CHO/HEK293)Native-like glycosylationLower yields, expensiveFunctional studies requiring authentic glycosylation
E. coliHigh yield, cost-effectiveNo glycosylationStructural studies of protein backbone
Insect cellModerate glycosylation, higher yield than mammalianGlycans differ from mammalianCompromise between yield and PTMs
In vitro cell-freeRapid expression, membrane protein-friendlyLimited scaleInitial characterization studies

For studies where glycosylation patterns are critical, mammalian systems are recommended despite their higher cost and complexity. When the extracellular domain alone is sufficient, secreted constructs can improve yields compared to full-length membrane-anchored versions .

What purification strategies yield highest quality recombinant pig GYPA?

Effective purification of recombinant pig GYPA involves several strategic considerations:

A multi-step purification workflow typically includes:

  • Affinity chromatography using N-terminal or C-terminal tags (His-tag being common for GYPA proteins)

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography for removing contaminating proteins and endotoxins

Special considerations include membrane solubilization if expressing full-length protein, maintaining glycan integrity during purification, and minimizing proteolytic degradation through protease inhibitor inclusion. For transmembrane regions, detergent selection is critical - mild non-ionic detergents like DDM or LMNG often preserve structural integrity better than harsher ionic detergents .

How should researchers assess quality and functionality of purified recombinant pig GYPA?

Comprehensive quality assessment includes:

Analytical MethodInformation ProvidedImplementation
SDS-PAGEPurity, approximate molecular weightStandard protocol with Coomassie or silver staining
Western blottingIdentity confirmation, degradation assessmentUsing anti-GYPA or anti-tag antibodies
Mass spectrometryPrecise mass, glycosylation profiling, sequence verificationLC-MS/MS with glycan-specific preparation methods
Circular dichroismSecondary structure confirmationFar-UV scanning to verify folding
Dynamic light scatteringHomogeneity, aggregation statusPre-analytical screening before functional assays

Functionality assessment should include binding studies with known interaction partners. For human GYPA, interaction with SLC4A1 (Band 3) is well-established and critical for protein function . Researchers should determine whether similar interactions exist with porcine SLC4A1 and develop appropriate binding assays.

What storage conditions maximize stability of recombinant pig GYPA?

Based on protocols for human GYPA , optimal storage conditions likely include:

  • Temperature: Store at -80°C for long-term stability

  • Buffer composition: pH 8.0 buffer containing stabilizers such as Tris-HCl and glutathione

  • Aliquoting: Single-use aliquots to avoid freeze-thaw cycles

  • Glycerol addition: 10-20% glycerol can improve cryostability

  • Lyophilization: Consider for extended storage if compatible with downstream applications

Researchers should empirically determine stability under various conditions by monitoring protein integrity using SDS-PAGE and functional assays after different storage durations. For glycosylated proteins like GYPA, glycan integrity should also be monitored during storage optimization .

How can post-translational modifications of recombinant pig GYPA be verified to ensure native-like glycosylation?

Glycosylation assessment requires specialized methodological approaches:

  • Glycan profiling workflow:

    • Release glycans using PNGase F (for N-glycans) and chemical β-elimination (for O-glycans)

    • Fluorescently label released glycans with 2-AB or procainamide

    • Analyze by HILIC-UPLC and/or mass spectrometry

    • Compare profiles with native pig erythrocyte GYPA (gold standard)

  • Site-specific glycosylation analysis:

    • Perform protease digestion optimized for glycopeptide generation

    • Analyze resulting glycopeptides by LC-MS/MS

    • Map specific glycans to their attachment sites

    • Compare occupancy rates at each site with native protein

Given GYPA's extensive O-glycosylation, particular attention should be paid to sialic acid content and O-glycan structures, as these directly impact biological functions including potential pathogen interactions .

What experimental approaches can determine the membrane dynamics and oligomerization state of pig GYPA?

Human GYPA forms homodimers in erythrocyte membranes - a property likely conserved in pig GYPA. Investigating these dynamics requires specialized biophysical techniques:

TechniqueApplicationExperimental Considerations
FRETOligomerization and proximity measurementsRequires fluorescent labeling that may affect function
Crosslinking MSIdentification of interaction interfacesChemical crosslinkers must be optimized for membrane environment
Blue-native PAGENative oligomeric state assessmentDetergent selection critically impacts results
Single-molecule trackingMembrane diffusion and clusteringRequires specialized microscopy and specific labeling strategies
Analytical ultracentrifugationSolution-state oligomerizationDetergent micelles complicate analysis

For membrane proteins like GYPA, reconstitution into model membrane systems (liposomes, nanodiscs) often provides more physiologically relevant results than detergent-solubilized preparations. Researchers should compare results across multiple techniques to build confidence in oligomerization state determination .

How can researchers overcome expression challenges when producing recombinant pig GYPA?

Membrane glycoproteins like GYPA present multiple expression challenges requiring systematic troubleshooting:

  • Low expression yields:

    • Optimize codon usage for expression host

    • Test different signal sequences for improved membrane targeting

    • Consider fusion partners (SUMO, MBP) to enhance folding

    • Implement temperature reduction during induction phase

    • Screen multiple cell lines (for mammalian expression)

  • Protein misfolding:

    • Add chaperone co-expression constructs

    • Optimize induction parameters (IPTC concentration, induction time)

    • Test expression of truncated constructs lacking difficult domains

  • Glycosylation heterogeneity:

    • Use glycosylation-specialized cell lines (GlycoDelete, GlycoSwitch)

    • Implement glycosylation inhibitors for simplified patterns

    • Consider enzymatic glycan remodeling post-purification

Systematic optimization requires parallel testing of multiple conditions, careful documentation, and quantitative comparison of yields and product quality across conditions .

What methodological approaches best elucidate pig GYPA interactions with potential pathogens?

Human GYPA serves as a receptor for various pathogens including Plasmodium falciparum and Hepatitis A virus . Investigating pig GYPA's potential pathogen interactions requires:

  • Binding assays:

    • Surface plasmon resonance for kinetic measurements

    • Enzyme-linked immunosorbent assays for high-throughput screening

    • Pull-down assays to identify novel binding partners

    • Flow cytometry with GYPA-expressing cells to verify surface interactions

  • Functional infection studies:

    • Transfection of non-susceptible cell lines with pig GYPA to test gain of susceptibility

    • CRISPR knockout of GYPA in susceptible cell lines to test loss of susceptibility

    • Competitive inhibition assays using recombinant GYPA or GYPA-derived peptides

  • Structural studies of binding interfaces:

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

    • Co-crystallization attempts with pathogen binding domains

    • Cryo-EM of complexes for larger interaction partners

These approaches should be implemented comparatively between pig and human GYPA to identify species-specific pathogen interactions that might impact xenotransplantation safety or the use of porcine models in pathogen research .

How can researchers design chimeric constructs to investigate functional domains of pig GYPA?

Domain swapping experiments provide powerful insights into structure-function relationships:

  • Design strategy for chimeric constructs:

    • Identify domain boundaries through sequence analysis and structural prediction

    • Design junction points in non-conserved, unstructured regions when possible

    • Create multiple variations of each chimera with different junction positions

    • Include epitope tags that minimally impact function

  • Expression optimization:

    • Test in multiple expression systems to identify optimal host

    • Screen different detergents if expressing membrane-anchored constructs

    • Verify proper folding through circular dichroism and thermal stability assays

  • Functional assessment workflow:

    • Begin with binding assays to known interaction partners

    • Progress to cell-based assays measuring membrane localization

    • Conduct pathogen binding/infection studies if relevant

    • Compare glycosylation patterns between chimeras and wild-type proteins

This systematic approach enables mapping of functional domains while identifying species-specific properties that may be relevant to comparative physiology or pathogen interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.