Recombinant Pig High affinity copper uptake protein 1 (SLC31A1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SLC31A1; CTR1; High affinity copper uptake protein 1; Copper transporter 1; Solute carrier family 31 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MDHSAHMGMSTHMGMSDMNHSTTMPPSHHHPTSSGSHESMMMPMTFYFGFKKVEVLFAGL VINTAGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHK TVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAV VVDITEHCH
Uniprot No.

Target Background

Function

High-affinity, saturable copper transporter involved in dietary copper uptake.

Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Localizes to the apical membrane in intestinal epithelial cells.

Q&A

How does SLC31A1 structure relate to its function?

SLC31A1 functions as a homotrimer in the cell membrane, creating a pore-like structure that facilitates copper transport . The protein contains structural features including an alpha-helix in the cytoplasmic gate region that is crucial for transport function . Specific amino acid residues, such as Arg95 and Arg102, appear to be particularly important, as mutations in these residues have been associated with impaired function in humans . The trimeric assembly creates a pathway that allows for the selective transport of copper ions from the extracellular environment into the cytoplasm, maintaining the tight regulation necessary for proper copper homeostasis.

What pathways and biological processes involve SLC31A1 in pigs?

SLC31A1 is involved in several critical pathways including metal ion SLC transport, mineral absorption, and transmembrane transport of small molecules . In pigs specifically, copper transport via SLC31A1 appears to enhance fat metabolism after absorption, resulting in increased energy utilization of the entire diet . Research indicates that copper supplementation in pig diets leads to better feed conversion rates and enhanced average daily gain, likely through the action of SLC31A1 in facilitating proper copper utilization . Gene expression studies have shown greater expression of genes involved in lipid metabolism and lipid utilization in the liver, adipose tissue, and to a lesser degree in muscle when copper is adequately available through this transport system .

What expression systems are most effective for producing recombinant pig SLC31A1?

For recombinant pig SLC31A1 production, mammalian expression systems typically yield the most functionally relevant protein product. Based on recombinant protein production patterns seen with other SLC31A1 homologs, HEK293 cells are often preferred for mammalian expression, as they provide appropriate post-translational modifications and membrane integration . E. coli systems can be used for producing portions of the protein for structural studies or antibody generation, but may not yield fully functional transporters. When using mammalian systems, optimization of expression conditions is essential, including consideration of copper concentrations in the growth medium, as high copper levels might feedback-inhibit the expression or function of the recombinant transporter.

What analytical methods are recommended for characterizing recombinant pig SLC31A1?

Characterization of recombinant pig SLC31A1 should include multiple analytical approaches. Western blotting is essential for confirming expression and assessing protein integrity . Functional characterization can be performed using copper uptake assays with radioactive copper (64Cu) or fluorescent copper indicators. For structural characterization, techniques such as circular dichroism can assess secondary structure, while more advanced methods like cryo-electron microscopy might be necessary to visualize the trimeric assembly. Assessment of protein-protein interactions can be conducted through co-immunoprecipitation or proximity ligation assays to identify binding partners that may regulate SLC31A1 function .

How can researchers effectively measure the copper transport activity of recombinant SLC31A1?

To measure copper transport activity of recombinant pig SLC31A1, researchers should employ multiple complementary approaches. Direct measurement of copper uptake can be performed using radioisotope-labeled copper (64Cu) in cells expressing the recombinant protein compared to control cells. Alternatively, fluorescent copper probes that change their spectral properties upon copper binding can be used for real-time monitoring of transport activity. Indirect measures include assessing the activity of copper-dependent enzymes (such as ceruloplasmin or cytochrome c oxidase) in cells expressing recombinant SLC31A1. For more sophisticated analysis, electrophysiological approaches can measure the electrical currents associated with copper transport across membranes in systems like Xenopus oocytes expressing the recombinant transporter.

How does SLC31A1 expression impact copper-dependent growth mechanisms in pigs?

SLC31A1 expression significantly impacts copper-dependent growth mechanisms in pigs through its role in copper homeostasis. Research has demonstrated that copper supplementation enhances pigs' ability to utilize fat after absorption, resulting in increased energy utilization of the entire diet . Pigs consuming diets with adequate copper (such as 150 milligrams of copper hydroxychloride per kilogram) experienced greater average daily gain and improved gain-to-feed ratio compared to those with minimal copper supplementation . Mechanistically, gene expression analysis revealed that copper enhances the expression of genes involved in lipid metabolism and utilization in liver, adipose tissue, and muscle . This suggests that SLC31A1, as the primary copper transporter, plays a crucial role in facilitating these metabolic improvements by ensuring appropriate cellular copper levels needed for enzymes and processes involved in energy metabolism.

How can recombinant pig SLC31A1 be leveraged in studying human copper-related disorders?

Recombinant pig SLC31A1 can serve as a valuable tool for studying human copper-related disorders due to the conservation of copper metabolism mechanisms across mammals. Recent research has identified bi-allelic mutations in human SLC31A1 associated with a neurodevelopmental disorder characterized by early-onset epileptic encephalopathy, severe neurodevelopmental delay, hypotonia, and high mortality . Specific mutations, such as p.His120Gln and p.(Arg102Cys/His), have been linked to impaired mitochondrial respiration . By creating analogous mutations in recombinant pig SLC31A1 and studying their functional consequences, researchers can develop valuable animal models that reflect human pathology. Such models can be used to investigate disease mechanisms, test therapeutic interventions, and evaluate copper chelation or supplementation strategies in a physiologically relevant system before moving to human clinical trials.

What role does SLC31A1 play in cancer biology and how might this inform veterinary oncology?

SLC31A1 has emerged as a significant factor in cancer biology, with potential implications for veterinary oncology. Research has shown that SLC31A1 is significantly up-regulated at both mRNA and protein levels in human bladder cancer tissue samples, and it exhibits hypomethylation in these tissues, which may contribute to its overexpression . Additionally, SLC31A1 serves as the major plasma-membrane transporter for platinum drug intake, including cisplatin, oxaliplatin, and carboplatin, which are commonly used in cancer treatment . The expression of SLC31A1 correlates with drug disposition and response, making it a potential biomarker for treatment outcomes . In veterinary oncology, these findings suggest that assessment of SLC31A1 expression in animal tumors might help predict response to platinum-based therapies. Furthermore, genetic variations in SLC31A1 might explain differential treatment responses observed in veterinary patients, potentially guiding more personalized treatment approaches.

How does SLC31A1 dysfunction contribute to neurodevelopmental disorders?

Recent research has revealed that bi-allelic mutations in SLC31A1 are associated with a distinct neurodevelopmental disorder . Affected individuals exhibit a clinical phenotype characterized by early-onset epileptic encephalopathy, severe neurodevelopmental delay, hypotonia, and high mortality . Neuroimaging typically shows significant brain atrophy and white matter abnormalities . Specific mutations, particularly p.His120Gln and p.(Arg102Cys/His), have been identified in multiple cases . Functional studies in patient fibroblasts demonstrated impaired mitochondrial respiration, suggesting that SLC31A1 dysfunction affects copper delivery to mitochondrial copper-dependent enzymes, disrupting energy production . This establishes a mechanistic link between copper transport deficiency and neurological impairment. Understanding these pathways could inform potential therapeutic strategies, such as copper supplementation or targeted copper delivery systems, though such approaches would require careful titration given copper's potential toxicity at high concentrations.

What therapeutic strategies might target SLC31A1 in disease states?

Based on the current understanding of SLC31A1 function and disease associations, several therapeutic strategies could potentially target this transporter:

  • For conditions with impaired SLC31A1 function (like the neurodevelopmental disorder described):

    • Development of novel copper delivery systems that bypass SLC31A1

    • Small molecule chaperones that could rescue misfolded SLC31A1 mutants

    • Gene therapy approaches to deliver functional SLC31A1 copies

  • For cancer treatment enhancement:

    • Modulators that increase SLC31A1 expression or activity to enhance platinum drug uptake

    • Combination therapies that prevent downregulation of SLC31A1 during platinum treatment

    • Genetic screening for SLC31A1 variants to personalize platinum drug dosing

  • For metabolic enhancement in livestock:

    • Optimized copper supplementation strategies based on SLC31A1 genetics

    • Nutritional interventions that maximize SLC31A1-dependent copper utilization

Each approach would require extensive preclinical validation, with particular attention to potential off-target effects given copper's essential but potentially toxic nature.

What are common challenges in expressing functional recombinant pig SLC31A1?

Expressing functional recombinant pig SLC31A1 presents several significant challenges. As a membrane protein that functions as a homotrimer, proper folding and assembly are critical for activity . Common issues include:

  • Protein misfolding and aggregation: The hydrophobic nature of transmembrane domains can lead to improper folding, especially in non-mammalian expression systems.

  • Low expression levels: Membrane proteins often express poorly compared to soluble proteins, requiring optimization of expression conditions and potentially fusion tags to enhance expression.

  • Functionality assessment: Confirming that the recombinant protein actually transports copper requires specialized assays that may be technically challenging.

  • Protein stability: Maintaining the stability of the purified protein, particularly if detergent extraction from membranes is necessary, can be difficult.

  • Post-translational modifications: Ensuring appropriate post-translational modifications that might be essential for function requires mammalian expression systems rather than bacterial systems.

Addressing these challenges typically requires systematic optimization of expression constructs, host cells, induction conditions, and purification protocols.

How can researchers assess the purity and quality of recombinant pig SLC31A1 preparations?

Assessing purity and quality of recombinant pig SLC31A1 preparations requires a multi-technique approach:

  • SDS-PAGE and Western blotting: To confirm molecular weight, detect degradation products, and verify identity using specific antibodies .

  • Size exclusion chromatography: To assess oligomeric state and detect aggregation, which is particularly important for confirming proper trimeric assembly of SLC31A1 .

  • Circular dichroism spectroscopy: To evaluate secondary structure integrity, particularly the alpha-helical content expected in properly folded SLC31A1.

  • Copper binding assays: To confirm functional copper-binding capability using isothermal titration calorimetry or fluorescence-based copper sensors.

  • Mass spectrometry: For detailed analysis of protein sequence, post-translational modifications, and potential contaminants.

  • Functional transport assays: To verify that the recombinant protein can actually transport copper, which is the ultimate quality criterion for a functional transporter.

Combining these approaches provides comprehensive quality assessment beyond simple purity measures, ensuring that the recombinant protein possesses the structural and functional characteristics necessary for research applications.

What emerging technologies might advance our understanding of SLC31A1 function in pigs?

Several emerging technologies hold promise for advancing our understanding of SLC31A1 function in pigs:

These technologies, especially when used in combination, could provide unprecedented insights into the multifaceted roles of SLC31A1 in pig physiology and disease.

How might research on pig SLC31A1 inform agricultural practices and animal health?

Research on pig SLC31A1 has significant potential to inform agricultural practices and improve animal health through several avenues:

  • Optimized nutritional strategies: Understanding how SLC31A1 mediates copper utilization could lead to more precise copper supplementation protocols tailored to maximize growth and feed efficiency while minimizing environmental copper discharge .

  • Genetic selection programs: Identifying favorable SLC31A1 variants associated with enhanced copper utilization and growth performance could inform breeding programs to develop pigs with improved feed conversion ratios .

  • Improved health management: As copper has antimicrobial properties, understanding SLC31A1's role in immunity could help develop strategies to reduce antibiotic use in pig production through optimized copper utilization.

  • Mitigation of copper-related disorders: Knowledge of SLC31A1 function could help address both copper deficiency and toxicity conditions in pig production through targeted interventions.

  • Development of biomarkers: SLC31A1 expression or genotype might serve as biomarkers for predicting growth performance or disease susceptibility in pig populations.

The economic impact of such advances could be substantial, given that feed efficiency is a primary determinant of profitability in pig production, and copper supplementation has already demonstrated significant effects on growth parameters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.