Recombinant Pig Insulin-induced gene 2 protein (INSIG2)

Shipped with Ice Packs
In Stock

Description

Structure and Function of INSIG2

INSIG2 is a transmembrane endoplasmic reticulum (ER) protein that regulates sterol and fatty acid metabolism by interacting with SREBP cleavage-activating protein (SCAP) and sterol regulatory element-binding proteins (SREBPs).

FeatureDescriptionSpecies ExampleSource
Protein LengthFull-length INSIG2 typically spans ~225–238 amino acids.Human, Pongo Abelii
Key DomainsContains a sterol-binding domain and regions for SCAP interaction.Human, Mouse
FunctionBinds SCAP in the ER, preventing SREBP processing and limiting lipogenesis.Mouse, Rat
RegulationInsulin downregulates liver-specific INSIG2a transcripts, promoting SREBP activation.Mouse, Rat

Key Mechanism:
INSIG2 sequesters SCAP in the ER, blocking its transport to the Golgi where SREBPs are proteolytically activated. This feedback mechanism suppresses cholesterol and fatty acid synthesis when sterol levels are high .

Production and Expression of Recombinant INSIG2

Recombinant INSIG2 is typically produced via bacterial (e.g., E. coli) or mammalian systems, with tags (e.g., His, GST) for purification.

Production SystemPurification TagPurityApplicationsSource
E. coliHis, GST>90% (SDS-PAGE)In vitro studies of SCAP/SREBP interactions
Mammalian cellsMyc/DDK~85% (SDS-PAGE)Functional assays, structural studies

Notes:

  • Pig-specific INSIG2 production details are not documented in available literature.

  • Human and rodent INSIG2 proteins share ~50–60% sequence identity, suggesting conserved structural motifs .

Applications in Research and Biomedical Studies

INSIG2 is critical for investigating lipid metabolism, obesity, and metabolic diseases.

Lipid Metabolism and Obesity

  • Role in SREBP Regulation: INSIG2 overexpression reduces hepatic triglycerides and SREBP-1c activity in diabetic rodent models .

  • Insulin Sensitivity: Liver-specific INSIG2a transcripts are suppressed by insulin, enabling SREBP-1c activation and fatty acid synthesis .

Cancer Research

  • Apoptosis Modulation: INSIG2 overexpression in colon cancer cells suppresses Bax activation, altering mitochondrial apoptosis pathways .

  • Hypoxia Response: INSIG2 is upregulated in hypoxic pancreatic cancer, linking it to malignant progression .

Drug Development

  • Target Validation: INSIG2 is a candidate for therapies targeting cholesterol synthesis (e.g., statins) or metabolic disorders .

Clinical and Research Findings

Study FocusKey FindingsRelevance to Pig INSIG2
Lipid HomeostasisINSIG2 binds oxysterols, regulating SCAP-SREBP retention in the ER .Similar mechanisms likely
Circadian RhythmREV-ERBα modulates INSIG2 expression, linking circadian cycles to lipid metabolism .Potential conserved pathway
Genetic VariantsPolymorphisms near INSIG2 (e.g., rs756605) are studied for obesity risk .Species-specific SNPs may exist

Limitations:

  • No direct studies on pig INSIG2 are available.

  • Data are extrapolated from human, rodent, and primate models.

Future Directions for Pig-Specific Studies

  1. Structural Analysis: Comparative modeling of pig INSIG2 using homologous structures (e.g., human INSIG2).

  2. Functional Assays: In vitro testing of pig INSIG2’s interaction with SCAP/SREBPs.

  3. Agricultural Applications: Exploring INSIG2’s role in porcine lipid metabolism for meat quality optimization.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
INSIG2; Insulin-induced gene 2 protein; INSIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
INSIG2
Target Protein Sequence
MAEGETKSPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Uniprot No.

Target Background

Function
INSIG2 is an oxysterol-binding protein that regulates cholesterol synthesis. It mediates feedback control by influencing both endoplasmic reticulum-to-Golgi transport of SCAP and the degradation of HMGCR. It acts as a negative regulator of cholesterol biosynthesis by retaining the SCAP-SREBP complex in the endoplasmic reticulum, thus preventing the processing of SREBPs (SREBF1/SREBP1 and SREBF2/SREBP2). INSIG2 binds oxysterols (including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol), modulating its interaction with SCAP and the retention of the SCAP-SREBP complex. In the presence of oxysterols, it interacts with SCAP, retaining the complex and preventing SCAP from escorting SREBPs to the Golgi. Sterol deprivation or PCK1-mediated phosphorylation reduces oxysterol binding, disrupting the INSIG2-SCAP interaction, promoting Golgi transport of the SCAP-SREBP complex, and subsequently processing and nuclear translocation of SREBPs. INSIG2 also regulates cholesterol synthesis by controlling HMGCR degradation, initiating sterol-mediated ubiquitin-mediated ERAD (ER-associated degradation) of HMGCR through recruitment to the ubiquitin ligase RNF139.
Gene References Into Functions
  1. The FASN gene is a promising marker for subcutaneous fat accumulation, while INSIG2 shows promise as a marker for fatty acid composition. PMID: 26965892
Database Links

KEGG: ssc:100170127

UniGene: Ssc.85396

Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary cellular function of INSIG2 protein?

INSIG2 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating lipid metabolism by inhibiting lipid synthesis through the sterol regulatory element-binding protein (SREBP) pathway. INSIG2 functions by blocking the transport of SREBP from the ER to the Golgi apparatus, thereby preventing the proteolytic activation of SREBPs and subsequent transcription of lipogenic genes. This mechanism is particularly important for maintaining cholesterol homeostasis in various tissues including the liver, which is the primary site of de novo lipogenesis in many species .

The protein forms part of a complex regulatory network involving SREBP cleavage-activating protein (SCAP), which acts as an escort protein for SREBPs. When cellular sterol levels are sufficient, INSIG2 binds to SCAP, retaining the SCAP/SREBP complex in the ER and preventing lipid synthesis. This negative feedback mechanism is essential for preventing excessive accumulation of lipids that could be detrimental to cellular function .

How does INSIG2 differ structurally and functionally from INSIG1?

While INSIG1 and INSIG2 share approximately 59% amino acid identity in humans and are both involved in regulating SREBP processing, they exhibit several key differences in structure and regulation that confer distinct physiological roles:

  • Phosphorylation site: INSIG2 contains a conserved serine residue at position 106 that can be phosphorylated by protein kinase A (PKA) when cells are exposed to polyunsaturated fatty acids (PUFAs). This serine residue is replaced by alanine in INSIG1 across all vertebrate species examined, preventing similar phosphorylation-based regulation .

  • Selective inhibition: Phosphorylated INSIG2 selectively inhibits the processing of SREBP-1 without affecting SREBP-2 processing, whereas INSIG1 appears to inhibit both SREBP isoforms equally when activated by sterols .

  • Regulatory mechanisms: INSIG1 is subject to rapid ubiquitination and degradation after dissociating from SCAP, while INSIG2 appears to be more stable and regulated primarily through post-translational modifications such as phosphorylation .

These differences suggest complementary rather than redundant roles for the two INSIG isoforms, with INSIG2 potentially serving as a specific regulator of fatty acid metabolism through its selective inhibition of SREBP-1 in response to PUFAs and cAMP signaling .

How conserved is INSIG2 across species, and what does this tell us about its evolutionary importance?

Phylogenetic analysis reveals that INSIG2 is highly conserved across vertebrate species, from mammals to fish, indicating strong evolutionary pressure to maintain its function. The critical serine-106 residue that serves as a phosphorylation site in INSIG2 is conserved in all vertebrates examined, including distant species such as zebrafish . This conservation contrasts with INSIG1, where the equivalent position is consistently replaced by alanine, despite the surrounding amino acid sequences being identical and highly conserved between the two INSIG isoforms .

The high degree of conservation suggests that the distinct regulatory mechanisms of INSIG2, particularly its ability to be phosphorylated in response to PUFAs and cAMP signaling, represent an evolutionarily ancient adaptation that provides additional flexibility in the regulation of lipid metabolism. Research in chicken has shown that both INSIG proteins are derived from common ancestors of their mammalian counterparts, further supporting the evolutionary importance of these proteins in vertebrate lipid homeostasis .

What are the optimal expression systems for producing functional recombinant pig INSIG2 protein?

For successful expression of functional recombinant pig INSIG2 protein, researchers should consider the following expression systems and methodological approaches:

  • Mammalian cell-based expression: Mammalian expression systems, particularly HEK293 or CHO cells, are generally preferred for producing functional INSIG2 due to the protein's requirement for proper membrane insertion and post-translational modifications. These systems provide the appropriate cellular environment for correct folding and insertion into the ER membrane, which is crucial for INSIG2 functionality .

  • Expression vector design: The expression vector should include a strong promoter (such as CMV for mammalian systems), a signal sequence to direct the protein to the ER, and an appropriate affinity tag (His-tag is commonly used) for purification that doesn't interfere with protein function .

  • Purification considerations: Due to INSIG2's nature as an integral membrane protein with multiple transmembrane domains, standard purification protocols need modification. Gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended for solubilization while maintaining protein structure and function. A two-step purification approach involving affinity chromatography followed by size exclusion chromatography typically yields the best results .

  • Quality control: Functional assessment should include evaluation of proper membrane insertion using subcellular fractionation, binding assays with known interactors like SCAP, and phosphorylation status using phospho-specific antibodies .

What are the validated methods for assessing INSIG2 phosphorylation at serine-106?

Assessment of INSIG2 phosphorylation at serine-106 requires specific methodological approaches:

  • Phospho-specific antibodies: The gold standard for detecting INSIG2 phosphorylation is using affinity-purified polyclonal antibodies specifically directed against the phosphorylated form of the S106-containing peptide. These antibodies should be validated using appropriate controls, including INSIG2 S106A mutants that cannot be phosphorylated .

  • Immunoprecipitation followed by western blotting: This approach involves first immunoprecipitating INSIG2 from cell lysates using a general anti-INSIG2 antibody, followed by western blotting with the phospho-specific antibody. This method allows detection of the phosphorylated form even when it represents a small fraction of the total INSIG2 pool .

  • Quantification using LI-COR imaging: For accurate quantification of phosphorylation levels, LI-COR infrared imaging systems provide superior linearity and sensitivity compared to traditional chemiluminescence methods .

  • Positive controls: Treatment of cells with 8-Bromo-cAMP (a cell-permeable cAMP analog) or polyunsaturated fatty acids like eicosapentaenoic acid (EPA) should be used as positive controls to induce INSIG2 phosphorylation. Researchers have documented that EPA induced the phosphorylation of INSIG2 at serine-106 by 3.5-, 9.6-, and 12.5-fold at concentrations of 1, 3, and 10 μM, respectively .

What cell culture models are most appropriate for studying INSIG2 function in lipid metabolism?

Several cell culture models have proven effective for studying INSIG2 function in lipid metabolism:

  • SV-589 fibroblasts: These human fibroblasts have been extensively used in INSIG2 research, particularly with INSIG1/INSIG2-deficient lines that allow reconstitution with wild-type or mutant INSIG2 constructs. This system provides a clean background for studying the specific effects of INSIG2 variants on SREBP processing and lipid metabolism .

  • Hepatocyte cell lines: Given INSIG2's important role in hepatic lipid metabolism, liver-derived cell lines such as human HepG2, Huh7, or avian LMH cells represent physiologically relevant models. These cells exhibit active lipid synthesis pathways and express the complete machinery for SREBP processing .

  • Genetic manipulation approaches: For optimal results, researchers should employ:

    • RNA interference (siRNA or shRNA) for acute or stable knockdown of endogenous INSIG2

    • CRISPR-Cas9 genome editing for complete knockout studies

    • Overexpression systems using appropriate vectors for wild-type INSIG2 or specific mutants (e.g., S106A phosphorylation-deficient variant)

  • Metabolic measurements: Effective functional assessment should include measurement of:

    • Triglyceride and cholesterol content using enzymatic assays

    • Expression of lipogenic genes (e.g., FASN, ACC) by qRT-PCR

    • SREBP processing by western blotting for precursor and nuclear forms

    • Lipid synthesis using radiolabeled acetate or glucose incorporation

How does PUFA-induced phosphorylation of INSIG2 selectively inhibit SREBP-1 but not SREBP-2 processing?

The selective inhibition of SREBP-1 processing by phosphorylated INSIG2 represents one of the most intriguing aspects of INSIG2 biology and warrants detailed investigation. Current research suggests several potential mechanisms:

  • Conformational changes in INSIG2: Phosphorylation of serine-106 likely induces a conformational change in INSIG2 that enhances its binding affinity specifically for the SCAP/SREBP-1 complex while having minimal effect on its interaction with SCAP/SREBP-2. This selective binding could prevent incorporation of SCAP/SREBP-1 into COPII vesicles while allowing SCAP/SREBP-2 complex transportation to the Golgi .

  • Differential recognition of SCAP conformations: Research suggests that SCAP may adopt slightly different conformations when bound to SREBP-1 versus SREBP-2. Phosphorylated INSIG2 might selectively recognize structural features of the SCAP/SREBP-1 complex that are absent in the SCAP/SREBP-2 complex .

  • Co-regulator recruitment: Phosphorylated INSIG2 might recruit additional co-regulatory proteins that specifically impede SREBP-1 processing without affecting SREBP-2. These co-regulators could include proteins involved in ER retention or components that interfere with COPII vesicle formation specifically for SREBP-1-containing complexes .

To investigate this mechanism, researchers should employ techniques such as: (1) proximity labeling approaches (BioID or APEX) to identify differential protein interactions of phosphorylated versus non-phosphorylated INSIG2; (2) structural biology methods including cryo-EM to visualize the complexes; and (3) domain swapping between SREBP-1 and SREBP-2 to identify the regions responsible for differential sensitivity to phosphorylated INSIG2 .

What is the role of microRNAs in regulating INSIG2 expression and function?

Recent research has revealed important roles for microRNAs in regulating INSIG2 expression:

  • Direct targeting by miR-130b-3p: INSIG2 has been identified as a direct target of miR-130b-3p, which binds to specific sites in the INSIG2 mRNA. Experimental evidence shows that miR-130b-3p mimic treatment significantly decreases both mRNA and protein levels of INSIG2 in chicken liver cells (LMH) .

  • Functional consequences of miRNA regulation: The inhibition of INSIG2 by miR-130b-3p results in decreased expression of key genes related to lipid metabolism and reduced triglyceride and cholesterol contents in liver cells. This suggests that miR-130b-3p may promote lipid synthesis and accumulation by suppressing INSIG2's inhibitory effect on SREBP processing .

  • Conservation of miRNA binding sites: Analysis of INSIG2 mRNA sequences across species reveals conservation of miR-130b-3p binding sites, indicating evolutionary importance of this regulatory mechanism .

  • Interaction with other regulatory pathways: The miRNA-mediated regulation of INSIG2 appears to be integrated with other regulatory mechanisms, including transcriptional control and post-translational modifications like phosphorylation. For instance, the inhibition of TG and TC content by miR-130b-3p can be restored by overexpression of INSIG2, demonstrating the specific nature of this regulatory interaction .

Researchers investigating miRNA regulation of INSIG2 should employ approaches such as luciferase reporter assays to confirm direct binding, site-directed mutagenesis of predicted binding sites, and in vivo studies using miRNA mimics or inhibitors to assess physiological relevance .

How does INSIG2 function differ between species and specific tissue contexts?

Research has uncovered significant species-specific and tissue-specific variations in INSIG2 function:

  • Species-specific differences: While the basic mechanism of INSIG2 in regulating SREBP processing appears conserved across vertebrates, important differences exist:

    • In mammals, INSIG2 functions primarily to inhibit cholesterol and fatty acid synthesis in response to sterols and PUFAs

    • In avian species, INSIG2 appears particularly important for regulating lipid metabolism during egg-laying periods, with expression levels in chicken liver significantly higher at 30 weeks (peak laying period) compared to 20 weeks

    • The relative importance of INSIG1 versus INSIG2 may vary between species, with some showing differential tissue distribution or regulatory responses

  • Tissue-specific functions: INSIG2 expression and function show notable tissue specificity:

    • In liver, INSIG2 primarily regulates de novo lipogenesis and VLDL secretion

    • In adipose tissue, INSIG2 may play roles in adipocyte differentiation and fat storage

    • In metabolic disease states, tissue-specific dysregulation of INSIG2 may contribute to pathogenesis

  • Developmental regulation: Expression patterns of INSIG2 vary during development and in response to physiological changes:

    • In avian species, hepatic INSIG2 expression increases significantly during the egg-laying period, suggesting a role in regulating the enhanced lipid metabolism required for egg production

    • Similar developmental or physiological regulation may occur in mammals during periods of altered lipid metabolism, such as pregnancy or lactation

To properly study these differences, researchers should employ comparative approaches using tissue samples or primary cells from multiple species, developmental stages, and physiological conditions. RNA-seq and proteomic analyses can provide comprehensive pictures of how INSIG2 networks differ across these contexts .

What are the key considerations for producing high-quality phospho-specific antibodies against INSIG2?

Developing reliable phospho-specific antibodies against INSIG2 requires careful attention to several critical factors:

  • Peptide design: The synthetic peptide used for immunization should:

    • Include the phosphorylated serine-106 centrally positioned within a 10-15 amino acid sequence

    • Contain unique sequence context to minimize cross-reactivity with other phosphoproteins

    • Be conjugated to an appropriate carrier protein (KLH or BSA) for immunization

  • Antibody validation: Comprehensive validation is essential and should include:

    • Western blotting comparing wild-type INSIG2 with the S106A mutant in both phosphorylated and non-phosphorylated states

    • Peptide competition assays using phosphorylated and non-phosphorylated peptides

    • Immunoprecipitation followed by mass spectrometry to confirm specificity

    • Testing across multiple cell types and species if cross-reactivity is desired

  • Common pitfalls: Researchers should be aware of frequent challenges:

    • Background reactivity with other phosphorylated proteins

    • Loss of antibody specificity over time or between lots

    • Differential reactivity under various sample preparation conditions

For optimal results, researchers have successfully used affinity-purified polyclonal antibodies directed against a synthetic peptide corresponding to amino acids 100-111 of human INSIG2 in which S106 was phosphorylated. This approach has provided specific detection of the phosphorylated form as confirmed by control experiments with the S106A mutant .

How can researchers effectively overcome challenges in studying INSIG2 as a membrane protein?

Working with INSIG2 presents typical membrane protein challenges that can be addressed through specialized approaches:

  • Expression optimization:

    • Use mammalian expression systems for proper folding and post-translational modifications

    • Consider fusion tags that enhance expression and membrane insertion

    • Implement inducible expression systems to minimize toxicity during high-level expression

  • Solubilization and purification:

    • Select appropriate detergents based on experimental goals (DDM, LMNG, or digitonin for functional studies)

    • Employ styrene maleic acid lipid particles (SMALPs) or nanodiscs to maintain the native lipid environment

    • Use gradient purification methods to separate properly folded protein from aggregates

    • Store purified protein with stabilizing agents to prevent denaturation

  • Functional assays:

    • Develop pull-down assays to assess interactions with SCAP and SREBP

    • Utilize reconstituted systems in liposomes to study membrane-dependent activities

    • Employ structural techniques suitable for membrane proteins (cryo-EM rather than crystallography)

  • Subcellular localization:

    • Confirm proper ER localization using fractionation and immunofluorescence

    • Fluorescent protein fusions should be carefully validated to ensure they don't disrupt localization or function

Researchers have successfully localized chicken INSIGs to the cellular endoplasmic reticulum using these approaches, confirming their expected subcellular distribution and suggesting conservation of functional properties across species .

What are the recommended controls for validating INSIG2 knockdown and overexpression experiments?

Proper experimental controls are essential for reliable interpretation of INSIG2 manipulation studies:

  • For knockdown experiments:

    • Include scrambled/non-targeting siRNA controls processed identically to experimental samples

    • Validate knockdown efficiency at both mRNA level (qRT-PCR) and protein level (western blot)

    • Use multiple independent siRNA sequences to rule out off-target effects

    • Include rescue experiments with siRNA-resistant INSIG2 constructs to confirm specificity of observed phenotypes

    • Monitor expression of related genes (e.g., INSIG1) to assess potential compensatory mechanisms

  • For overexpression experiments:

    • Use empty vector controls processed identically to INSIG2 expression vectors

    • Validate expression levels by western blotting

    • Include subcellular localization studies to confirm proper ER localization

    • Use multiple expression levels to establish dose-response relationships

    • Include non-functional mutants (e.g., S106A) as controls for specific functions

  • Functional validation:

    • Monitor multiple downstream effects including:
      a) SREBP processing (nuclear vs. precursor forms)
      b) Target gene expression (FASN, ACACA, HMGCR)
      c) Lipid content (triglycerides and cholesterol)
      d) Lipidomic profiles when possible

Studies in chicken LMH cells demonstrated that knockdown of INSIG2 significantly decreased TG and TC contents and expressions of key genes related to lipid metabolism, providing strong evidence for INSIG2's role in regulating lipid homeostasis. Similarly, overexpression studies should include these comprehensive measurements to fully characterize functional effects .

What are the potential therapeutic applications of targeting the INSIG2 pathway for metabolic disorders?

The central role of INSIG2 in lipid metabolism regulation makes it an attractive target for therapeutic intervention in metabolic disorders:

  • Hepatic steatosis and NAFLD/NASH: Enhancing INSIG2 activity or expression could potentially reduce excessive lipid accumulation in the liver by inhibiting SREBP-1 processing and subsequent lipogenesis. This approach could be particularly effective since INSIG2 selectively inhibits fatty acid synthesis without affecting cholesterol metabolism when phosphorylated at S106 .

  • Metabolic syndrome and dyslipidemia: Modulating INSIG2 function could improve lipid profiles by affecting VLDL production and secretion. Research in avian models has shown that knockdown of INSIG2 affects expression of ApoB and other genes involved in lipoprotein assembly .

  • Therapeutic strategies:

    • Small molecules that enhance PKA-mediated phosphorylation of INSIG2

    • Compounds that stabilize the interaction between phosphorylated INSIG2 and the SCAP/SREBP-1 complex

    • RNA therapeutics targeting miRNAs that regulate INSIG2 (e.g., inhibitors of miR-130b-3p)

    • Gene therapy approaches to increase INSIG2 expression in specific tissues

  • Potential advantages over current approaches:

    • Selective modulation of fatty acid versus cholesterol metabolism

    • Targeting an early step in the lipogenic pathway

    • Possibility of tissue-specific intervention

The selective nature of INSIG2 phosphorylation in inhibiting SREBP-1 but not SREBP-2 processing offers a unique opportunity to specifically target fatty acid metabolism without disrupting cholesterol homeostasis, potentially reducing side effects compared to broader lipid-lowering approaches .

How might advanced structural biology techniques contribute to understanding INSIG2 function?

Recent advances in structural biology techniques offer unprecedented opportunities to elucidate INSIG2 function at the molecular level:

  • Cryo-electron microscopy (cryo-EM):

    • Could reveal the three-dimensional structure of INSIG2 alone and in complex with SCAP and SREBP

    • Might capture different conformational states associated with phosphorylated versus non-phosphorylated INSIG2

    • Could help explain how phosphorylated INSIG2 distinguishes between SCAP/SREBP-1 and SCAP/SREBP-2 complexes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Would provide insights into conformational changes induced by phosphorylation

    • Could map regions of INSIG2 involved in protein-protein interactions

    • Might identify differences in dynamics between wild-type and mutant INSIG2

  • Cross-linking mass spectrometry (XL-MS):

    • Would define contact points between INSIG2 and its binding partners

    • Could reveal how phosphorylation alters the interaction interface

  • Integrative structural biology approaches:

    • Combining multiple techniques (cryo-EM, HDX-MS, computational modeling, etc.)

    • Would provide comprehensive understanding of the structural basis for INSIG2 function

    • Could guide structure-based drug design targeting specific INSIG2 interactions or conformations

These structural insights would be particularly valuable for understanding the fundamental question raised in research: how does phosphorylated INSIG2 selectively recognize the SCAP/SREBP-1 complex but not the SCAP/SREBP-2 complex? This mechanistic understanding could guide rational design of therapeutics targeting specific aspects of INSIG2 function .

What is the potential role of INSIG2 in non-hepatic tissues and non-metabolic diseases?

While INSIG2's function in hepatic lipid metabolism is well-established, emerging evidence suggests broader physiological and pathological roles:

  • Neurological disorders:

    • Lipid metabolism plays crucial roles in brain function and neurodegeneration

    • INSIG2 may regulate myelination processes through control of fatty acid synthesis

    • The selective regulation of SREBP-1 by phosphorylated INSIG2 could be particularly relevant in neurons, where specific lipid compositions are critical

  • Cancer metabolism:

    • Many cancers exhibit altered lipid metabolism to support rapid proliferation

    • INSIG2 might function as a metabolic checkpoint in cancer cells

    • miRNA-mediated regulation of INSIG2 could contribute to metabolic reprogramming in tumors

  • Immune cell function:

    • Lipid metabolism is increasingly recognized as important for immune cell activation and function

    • INSIG2 might regulate the metabolic shifts required during immune cell activation

    • The cAMP-PKA-INSIG2 axis could integrate metabolic regulation with immune signaling

  • Reproductive biology:

    • In avian species, INSIG2 expression increases during egg-laying periods, suggesting roles in reproductive physiology

    • Similar roles might exist in mammalian pregnancy and lactation, which involve substantial lipid metabolic adaptations

    • Research in chicken has shown that INSIG2 expression levels in the liver at 30 weeks (egg-laying period) were significantly higher than at 20 weeks

Investigation of these potential roles requires tissue-specific knockout models, metabolic profiling across diverse physiological states, and integration of INSIG2 into broader signaling networks beyond the canonical SREBP pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.