Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Immune Signaling

IL2RA is indispensable for forming the high-affinity IL-2 receptor. Key mechanistic insights include:

  • Receptor Assembly: IL2RA combines with IL2RB and IL2RG to activate downstream JAK-STAT, PI3K, and MAPK pathways, driving T-cell survival and regulatory T-cell (Treg) function .

  • Immune Regulation: In pigs, IL2RA expression remains stable even in IL2RG-deficient models, suggesting its independent role in maintaining baseline T-cell receptor signaling .

  • Expression Dynamics: Porcine CD8+ T-cells upregulate IL2RA upon stimulation (e.g., PMA/ionomycin), correlating with effector differentiation and memory cell development .

3.1. Immune Dysfunction Models

Studies on monoallelic IL2RG knockout pigs revealed a T-B+NK- severe combined immunodeficiency (SCID) phenotype. Despite reduced IL2RG mRNA, IL2RA expression remained unchanged, highlighting its resilience in partial immunodeficiency contexts .

3.2. Transcriptomic Profiling

Stimulation of porcine dendritic cells and T-cell subsets showed:

  • Upregulation: IL2RA and IL2RG are co-expressed in naïve (T<sub>n</sub>) and intermediate (T<sub>inter</sub>) CD8+ T-cells during activation .

  • Pathway Activation: IL2RA-associated signaling is critical for balancing effector T-cell subsets (Th1, Th17) and immune tolerance .

Comparative Insights Across Species

While human IL2RA shares functional homology with porcine IL2RA, structural differences exist:

  • Sequence Variability: The porcine IL2RA extracellular domain (Gly22–Gln245) shows distinct glycosylation patterns compared to human and rat orthologs .

  • Disease Relevance: Elevated soluble IL2RA levels are biomarkers in human autoimmune diseases and carcinomas, a correlation under investigation in swine models .

Applications in Biomedical Research

  • Therapeutic Development: Used to study IL-2/IL2RA-targeted therapies for autoimmune disorders and SCID .

  • Immune Monitoring: Detects T-cell activation status in porcine vaccine studies and infectious disease models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
IL2RA; Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; CD antigen CD25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-270
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQLAVAGCVLLLLSILLLSGLTWQRRR
Uniprot No.

Target Background

Function
Interleukin-2 receptor subunit alpha (IL2RA) is a receptor for interleukin-2. It plays a crucial role in regulating immune tolerance by controlling the activity of regulatory T cells (TREGs). TREGs suppress the activation and expansion of autoreactive T-cells.
Gene References Into Functions
  1. IL2-R was equally expressed in interfollicular tissue and follicles. However, in moderate and severe cases of postweaning multisystemic wasting syndrome, it was only detected in interfollicular remnants. PMID: 17099157
  2. The appearance of CD25 after activation of porcine dendritic cells has been reported. PMID: 19036453
Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is porcine IL2RA and what role does it play in the immune system?

Porcine Interleukin-2 Receptor Subunit Alpha (IL2RA), also known as CD25, is a key component of the high-affinity interleukin-2 (IL-2) receptor complex. It functions together with IL-2 receptor beta (IL2RB) and the common gamma chain (IL2RG) to form the complete high-affinity IL-2 receptor, while IL2RA alone forms a low-affinity receptor for IL-2 . IL2RA is constitutively expressed on regulatory T cells (Tregs) and is upregulated in activated T cells, playing a crucial role in immune homeostasis .

The IL2RA subunit is involved in several critical biological processes, including:

  • Regulation of T cell homeostatic proliferation

  • Positive regulation of activated T cell proliferation

  • Negative regulation of immune and inflammatory responses

  • T cell differentiation and apoptosis

How does the structure of porcine IL2RA compare to human IL2RA?

While the search results don't provide direct structural comparisons between porcine and human IL2RA, human IL2RA consists of 272 amino acid residues with a molecular weight of approximately 30,819 Da . The human protein features:

  • Signal regions (amino acids 1-21)

  • Transmembrane regions (amino acids 241-259)

  • Sushi domain (PF00084)

  • Theoretical pI of 6.49

Porcine IL2RA likely shares significant structural homology with human IL2RA given the conserved nature of this receptor across mammalian species. Both function as receptors for IL-2 and are involved in similar immunological processes. Expression studies in porcine models show that IL2RA is expressed in the spleen and thymus, particularly in the germinal centers and medulla regions, respectively .

What methods can be used to detect and quantify IL2RA expression in porcine tissues?

Several complementary methods can be used to detect and quantify IL2RA expression in porcine tissues:

MethodApplicationAdvantagesInformation Provided
Immunohistochemistry (IHC)Tissue sectionsPreserves spatial contextCell-specific expression patterns and tissue localization
RT-qPCRRNA from tissues/cellsSensitive quantificationTranscriptional regulation of IL2RA
Flow cytometryCell suspensionsSingle-cell resolutionSurface expression levels on specific cell populations
Western blottingProtein lysatesProtein size verificationTotal protein expression levels

Research has demonstrated that IL2RA-positive cells can be detected in various porcine lymphoid tissues, with distinct expression patterns in different compartments. For example, CD25-positive cells have been detected in the red pulp and splenic nodules of wild-type pigs, while expression patterns are altered in IL2RG-modified pigs .

What expression systems are most effective for producing functional recombinant porcine IL2RA?

Based on related research with porcine IL-2 fusion proteins, several expression systems can be considered for recombinant porcine IL2RA production:

Expression SystemAdvantagesConsiderationsApplications
Pichia pastorisSupports glycosylation; High yieldGlycosylation patterns differ from mammalian cellsSuccessfully used for porcine IL-2 fusion proteins
Mammalian cellsNative-like post-translational modificationsLower yield; Higher costOptimal for functional studies requiring authentic structure
E. coliSimple; Cost-effective; High yieldLimited post-translational modificationsSuitable for non-glycosylated protein domains

Research with porcine IL-2 fusion toxins has demonstrated that glycosylation status significantly affects protein functionality, with non-glycosylated bivalent fusion toxins showing stronger binding to CD25 on target cells compared to glycosylated variants . This suggests that careful consideration of post-translational modifications is crucial when selecting an expression system for recombinant IL2RA.

How can researchers verify the functional activity of recombinant porcine IL2RA?

Verifying the functional activity of recombinant porcine IL2RA requires multiple complementary approaches:

  • Binding assays:

    • Surface plasmon resonance (SPR) to measure binding kinetics to porcine IL-2

    • ELISA-based binding assays to quantify IL-2/IL2RA interactions

  • Cell-based functional assays:

    • Competitive binding with native IL2RA on porcine CD25+ cells

    • Using porcine CD25+ cell lines (such as LCL13271) to assess binding specificity

  • Signaling pathway analysis:

    • Assessment of JAK/STAT pathway activation

    • Evaluation of downstream transcriptional changes associated with IL-2 signaling

  • Structural integrity verification:

    • Circular dichroism spectroscopy to confirm proper protein folding

    • Size exclusion chromatography to assess oligomeric state

Research has shown that proper functionality of IL-2 receptor components is critical for immune cell development and function, as evidenced by the developmental arrest observed in IL2RG-modified pigs with altered IL2RA expression patterns .

What are the critical quality attributes that should be assessed for recombinant porcine IL2RA preparations?

Quality assessment of recombinant porcine IL2RA should include:

Quality AttributeAssessment MethodSignificance
PuritySDS-PAGE, HPLCEnsure absence of contaminating proteins
IdentityMass spectrometry, Western blottingConfirm correct primary structure
Glycosylation profileLectin analysis, Mass spectrometryDetermine post-translational modifications
Conformational integrityCircular dichroism, Thermal shift assaysVerify proper protein folding
Aggregation stateSize exclusion chromatography, Dynamic light scatteringAssess protein homogeneity
Endotoxin levelsLAL assayEnsure preparation is endotoxin-free for cell-based experiments
Binding affinitySPR, ELISAConfirm functional activity

Studies with porcine IL-2 fusion toxins have demonstrated that different preparations (glycosylated vs. non-glycosylated, monovalent vs. bivalent) exhibit varying functional properties, highlighting the importance of thorough characterization .

What role does IL2RA play in porcine T cell development?

IL2RA plays a critical role in porcine T cell development, particularly during thymic development stages:

How is IL2RA expression regulated during porcine immune responses?

The regulation of IL2RA expression during porcine immune responses involves multiple mechanisms:

  • Constitutive vs. inducible expression: Regulatory T cells constitutively express high levels of IL2RA, while conventional T cells upregulate IL2RA upon activation .

  • Tissue-specific expression patterns: IL2RA shows distinct expression patterns in different lymphoid tissues. In the spleen, CD25-positive cells are detected in the red pulp and splenic nodules, while in IL2RG-modified pigs, CD25-positive cells are primarily found in germinal centers .

  • Transcriptional regulation: IL2RA expression is influenced by various transcription factors and cytokine signaling pathways. In IL2RG-modified pigs, altered expression of factors like DNM2, GNRH1, IL-4, and IL-21 has been observed, which may indirectly affect IL2RA expression and function .

  • Co-expression with other markers: CD25-positive cells in the thymus may co-express FOXP3, indicating their regulatory T cell identity. Additionally, CD25 can be co-expressed with CD44 and/or CD3 on developing T cells .

What is the significance of IL2RA in regulatory T cell function in pigs?

IL2RA (CD25) is critically important for regulatory T cell (Treg) function in pigs:

  • Identification marker: CD25 serves as a key surface marker for identifying porcine Tregs, particularly when co-expressed with FOXP3 .

  • IL-2 responsiveness: High expression of IL2RA allows Tregs to effectively respond to low concentrations of IL-2, which is essential for their survival and suppressive function.

  • Therapeutic targeting: The constitutive expression of CD25 on Tregs makes it possible to selectively target these cells using approaches such as IL-2 fusion toxins. This has been demonstrated with diphtheria toxin-based porcine IL-2 fusion toxins that can deplete CD25+ cells, providing a valuable tool for studying immune regulation .

  • Immune homeostasis: Tregs expressing IL2RA play a crucial role in maintaining immune homeostasis by suppressing excessive immune responses. IL2RA is involved in "negative regulation of immune response" and "negative regulation of inflammatory response" .

Studies using porcine CD25+ cells have shown that targeted depletion of these cells using IL-2 fusion toxins can significantly impact immune responses, highlighting the importance of IL2RA-expressing cells in immune regulation .

How can recombinant porcine IL2RA be used to study transplantation immunology?

Recombinant porcine IL2RA offers several research applications in transplantation immunology:

  • Treg manipulation strategies: Since regulatory T cells (Tregs) expressing high levels of IL2RA are crucial for transplantation tolerance, recombinant IL2RA could be used to develop tools for manipulating Treg populations to promote graft acceptance.

  • Targeted immunomodulation: Fusion proteins incorporating recombinant IL2RA could be designed to target specific immune cell populations involved in graft rejection. This approach has been demonstrated with IL-2 fusion toxins targeting CD25+ cells .

  • Biomarker development: Recombinant IL2RA could be used to develop assays for detecting anti-IL2RA antibodies or measuring soluble IL2RA levels as biomarkers of rejection or tolerance in transplantation settings.

  • Ex vivo expansion protocols: Protocols utilizing recombinant IL2RA could be developed for the ex vivo expansion of donor-specific Tregs for adoptive transfer to promote transplantation tolerance.

  • Comparative studies: Recombinant porcine IL2RA allows for comparative studies between human and porcine transplantation models, enhancing the translational relevance of porcine models.

What insights can be gained from studying IL2RA in genetic knockout or modified pig models?

Studies of IL2RA in genetically modified pig models have provided several key insights:

  • Developmental checkpoints: Analysis of IL2RA expression in IL2RG-modified pigs revealed that T cell development is arrested between the DN3 (CD44-CD25+) and DN4 (CD44-CD25-) stages, identifying a critical species-specific developmental checkpoint .

  • Receptor interdependence: While IL2RG modification significantly reduced IL2RG mRNA levels, IL2RA and IL2RB mRNA expression remained unchanged, suggesting potential compensatory mechanisms .

  • Tissue architecture effects: IL2RG modification altered the distribution of CD25+ cells in lymphoid tissues, with CD25+ cells predominantly found in germinal centers rather than in red pulp and splenic nodules as seen in wild-type pigs .

  • Signaling pathway integration: Studies in IL2RG-modified pigs have revealed complex interactions between IL-2 receptor components and other signaling pathways. Analysis of potential IL2RG interaction networks identified multiple upstream and downstream factors that may influence IL2RA function .

  • Species-specific differences: Comparative analysis of IL2RA expression and function in porcine models versus murine models has highlighted important species-specific differences in immune development and regulation .

How can recombinant porcine IL2RA be utilized in cancer immunotherapy research?

Recombinant porcine IL2RA has several potential applications in cancer immunotherapy research:

  • Targeted depletion of immunosuppressive cells: IL-2 fusion toxins targeting CD25+ cells have shown efficacy in tumor models. A bivalent glycosylated porcine IL-2 fusion toxin significantly prolonged survival (p=0.028) in tumor-bearing mice, demonstrating the potential of targeting IL2RA-expressing cells in cancer therapy .

  • Modulation of tumor microenvironment: Tools based on recombinant IL2RA could be used to study and manipulate the balance between effector and regulatory T cells within the tumor microenvironment.

  • Development of novel immunotherapeutics: Insights gained from studying IL2RA in porcine models could inform the development of novel immunotherapeutic approaches that modulate IL-2 signaling to enhance anti-tumor immunity.

  • Comparative oncology models: Porcine cancer models incorporating IL2RA-targeted approaches could serve as valuable platforms for testing cancer immunotherapies before human clinical trials.

  • Biomarker identification: Studies utilizing recombinant IL2RA could help identify biomarkers predictive of response to immunotherapy or indicators of immune activation following treatment.

What are the common challenges in expressing and purifying functional recombinant porcine IL2RA?

Several challenges may arise when producing recombinant porcine IL2RA:

ChallengePotential SolutionRationale
Proper glycosylationUse mammalian or yeast expression systemsGlycosylation affects IL2RA functionality as demonstrated with IL-2 fusion toxins
Transmembrane domain solubilityExpress only the extracellular domainThe transmembrane region (aa 241-259 in human IL2RA) can cause solubility issues
Protein aggregationOptimize buffer conditions and add stabilizersMaintaining native conformation is critical for functionality
Low yieldScale-up production or optimize expression conditionsSufficient quantities are needed for comprehensive studies
Protein degradationAdd protease inhibitors during purificationIL2RA can undergo extracellular proteolysis to form soluble IL2RA
Functional verificationDevelop robust binding and functional assaysBinding to IL-2 and signaling capacity are essential for functionality

Research with IL-2 fusion toxins has demonstrated that different preparation methods significantly affect functionality, with non-glycosylated variants showing stronger binding to CD25 on target cells .

How can researchers address variability in IL2RA expression studies?

To address variability in IL2RA expression studies, researchers should consider:

  • Standardized protocols: Develop and strictly follow standardized protocols for tissue collection, cell isolation, and analysis to minimize technical variability.

  • Comprehensive marker panels: When analyzing IL2RA expression by flow cytometry or immunohistochemistry, use multiple markers (e.g., CD3, CD4, CD8, FOXP3, CD44) to clearly define cell populations .

  • Consistent tissue sampling: Given the tissue-specific expression patterns of IL2RA (e.g., differences between spleen and thymus) , ensure consistent sampling from anatomically identical regions.

  • Age-matched animals: IL2RA expression changes during development, so use age-matched animals to control for developmental variability.

  • Genetic background consideration: When possible, use animals with defined genetic backgrounds, particularly when studying modified or knockout pigs.

  • Multiple detection methods: Combine protein-level detection (immunohistochemistry, flow cytometry) with mRNA analysis (RT-qPCR) to provide complementary data .

  • Appropriate statistical analysis: Apply robust statistical methods suitable for the experimental design and sample size to account for biological variability.

What controls should be included when designing experiments involving recombinant porcine IL2RA?

Rigorous experimental design for studies involving recombinant porcine IL2RA should include:

Control TypePurposeExamples
Positive controlsVerify assay functionalityKnown IL2RA-expressing cell lines; Commercial IL2RA protein standards
Negative controlsEstablish background levelsCells lacking IL2RA expression; Isotype control antibodies
Specificity controlsConfirm target specificityCompetitive binding with unlabeled IL2RA or IL-2; IL2RA-depleted samples
Process controlsMonitor technical variablesStandardized cell lines processed alongside experimental samples
Biological controlsAccount for biological variabilityAge-matched wild-type animals; Multiple biological replicates
Treatment controlsEvaluate treatment effectsVehicle-only controls; Irrelevant protein controls
Validation controlsVerify findings with alternative methodsConfirm protein expression with multiple antibodies; Validate mRNA expression with protein detection

Research with IL-2 fusion toxins has demonstrated the importance of proper controls, with different variants (glycosylated vs. non-glycosylated, monovalent vs. bivalent) showing varying efficacy in targeting CD25+ cells .

How might gene editing technologies enhance our understanding of IL2RA function in porcine models?

Gene editing technologies offer several opportunities to advance our understanding of IL2RA function:

  • Precise genetic modifications: CRISPR-Cas9 or TALEN approaches (as used for IL2RG modification ) could create pigs with specific IL2RA modifications, including:

    • Complete IL2RA knockout

    • Domain-specific mutations

    • Reporter gene knockins

    • Humanized IL2RA variants

  • Conditional expression systems: Development of pigs with inducible or cell-type-specific IL2RA expression would allow temporal and spatial control of IL2RA function.

  • Mechanistic studies: Introduction of specific mutations could help dissect the mechanistic details of IL2RA signaling and interaction with other IL-2 receptor components.

  • Comparative immunology: Creating pigs with humanized IL2RA would facilitate comparative studies between human and porcine immune responses, enhancing translational relevance.

  • Disease modeling: Gene editing could generate pigs with IL2RA variants associated with human immunological disorders, creating valuable models for studying disease mechanisms and testing therapeutic approaches.

What novel applications of recombinant porcine IL2RA are emerging in immunotherapy research?

Emerging applications of recombinant porcine IL2RA in immunotherapy research include:

  • Targeted immunomodulation: Building on the success of IL-2 fusion toxins , recombinant IL2RA could be incorporated into novel constructs for selective targeting of specific immune cell populations.

  • Checkpoint modulation: As IL2RA is involved in regulating immune responses, recombinant IL2RA-based approaches could be developed as alternatives or complements to existing checkpoint inhibitors.

  • Tolerance induction: Recombinant IL2RA-based strategies could be explored for inducing immune tolerance in autoimmune disease or transplantation settings by modulating the balance between effector and regulatory T cells.

  • Diagnostic tools: Recombinant IL2RA could be used to develop assays for monitoring immune activation or predicting response to immunotherapy.

  • Combination therapies: Integration of IL2RA-targeted approaches with other immunotherapeutic strategies could enhance efficacy while minimizing side effects.

These applications build on foundational research demonstrating the potential of targeting IL2RA-expressing cells for therapeutic benefit, as shown with IL-2 fusion toxins in tumor models .

How could integrating IL2RA studies with systems biology approaches advance porcine immunology?

Integration of IL2RA studies with systems biology approaches offers several opportunities:

  • Network analysis: Building on the "putative IL2RG interaction network" approach , comprehensive network analyses could reveal previously unknown interactions and regulatory relationships involving IL2RA in the porcine immune system.

  • Multi-omics integration: Combining IL2RA expression data with other omics data (proteomics, metabolomics, epigenomics) could provide a more comprehensive understanding of IL2RA's role in different immune contexts.

  • Computational modeling: Mathematical modeling of IL-2 signaling pathways incorporating IL2RA could help predict the effects of experimental manipulations and generate new hypotheses.

  • Single-cell analyses: Applying single-cell RNA sequencing to IL2RA-expressing cells could reveal heterogeneity within seemingly uniform populations and identify new cell states or subtypes.

  • Comparative immunology: Systems-level comparisons of IL2RA function across species could identify conserved and divergent aspects of immune regulation, as highlighted by the identification of species-specific differences in T cell development between pigs and mice .

  • Pathway integration: Understanding how IL2RA signaling integrates with other immunological pathways, such as those involving IL-4 and IL-21, which showed altered expression in IL2RG-modified pigs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.