Recombinant Pig Interleukin-23 subunit alpha (IL23A)

Shipped with Ice Packs
In Stock

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Available in Liquid or Lyophilized powder form.
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Synonyms
IL23A; SGRF; Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19
Datasheet & Coa
Please contact us to get it.
Expression Region
23-193aa
Mol. Weight
26.1 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
RAVPEGSSPAWAQGQQLSQQLCTLAWTAHLPMGHVDLPREEGDDETTSEVPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Recombinant Pig Interleukin-23 subunit alpha (IL23A) plays a crucial role in both innate and adaptive immunity. It forms a heterodimeric cytokine, IL-23, by associating with IL12B. IL-23, in conjunction with IL-17, contributes to an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex comprising IL12RB1 and IL23R, triggering the Jak-Stat signaling cascade. This activation stimulates memory T-cells rather than naive T-cells and promotes the production of proinflammatory cytokines. IL-23 is implicated in autoimmune inflammation and may be involved in autoimmune inflammatory diseases and tumorigenesis.
Gene References Into Functions
  1. These findings provide genetic insights into both swine IL-23, the IL-23 receptor alpha (IL-23Ralpha), and IL-12 receptor beta1 (IL-12Rbeta1). This knowledge enhances our understanding of interleukin systems involved in pig immunity. PMID: 22032895
Database Links

KEGG: ssc:100155546

UniGene: Ssc.56047

Protein Families
IL-6 superfamily
Subcellular Location
Secreted.

Q&A

What is Recombinant Pig Interleukin-23 Subunit Alpha (IL23A)?

Recombinant Pig Interleukin-23 subunit alpha (IL23A) is the laboratory-produced version of the naturally occurring p19 subunit that forms part of the heterodimeric cytokine IL-23 in pigs. The protein has a molecular weight of approximately 26.1 kDa and typically encompasses amino acids 23-193 of the mature protein sequence. When correctly paired with the p40 subunit (IL12B), it forms biologically active IL-23, which plays critical roles in both innate and adaptive immune responses in pigs. The recombinant form is usually produced in expression systems such as E. coli and may include affinity tags (commonly His-tag or Myc-tag) to facilitate purification and detection . As a key immunoregulatory molecule, IL23A contributes to Th17 cell development, cytokine production, and various immune functions relevant to disease resistance in pigs.

What Expression Systems Are Commonly Used for Producing Recombinant Pig IL23A?

Production of high-quality recombinant pig IL23A can be achieved through several expression systems, each with distinct advantages:

Expression SystemAdvantagesTypical ApplicationsSource
E. coliCost-effective, high yield, rapid productionFunctional studies, antibody production
HEK293 cellsProper protein folding, post-translational modificationsBioactivity assays, structural studies
Eukaryotic plasmid vectorsIn vivo expression, co-expression with partner proteinsVaccine adjuvant studies, immunotherapy

For the production of biologically active IL-23, researchers must consider co-expression of both IL23A (p19) and IL12B (p40) subunits, as demonstrated in the human recombinant IL-23 production method where both subunits are co-transfected in HEK293 cells . When high purity is required, the recombinant protein can be produced with affinity tags (such as N-terminal 10xHis-tag and C-terminal Myc-tag), which facilitate downstream purification processes and yield preparations with >85% purity as determined by SDS-PAGE .

What Are the Optimal Storage Conditions for Recombinant Pig IL23A?

Proper storage is critical for maintaining the biological activity of recombinant pig IL23A. Based on established protocols, the following storage conditions are recommended:

FormStorage TemperatureShelf LifeBuffer CompositionNotes
Liquid-20°C to -80°C6 monthsTris/PBS-based buffer with 5-50% glycerolAvoid repeated freeze-thaw cycles
Lyophilized-20°C to -80°C12 monthsTris/PBS-based buffer with 6% Trehalose (pre-lyophilization)Reconstitute in deionized sterile water
Working aliquots4°CUp to 1 weekSame as storage bufferPrepare small aliquots to minimize freeze-thaw cycles

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial prior to opening, and reconstitute to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% is advised for long-term storage, with 50% being the standard recommendation for maximum stability . These precautions help preserve the structural integrity and biological activity of the recombinant protein for experimental applications.

How Is Recombinant Pig IL23A Purified and Characterized?

Purification and characterization of recombinant pig IL23A involve multiple complementary techniques to ensure both purity and biological activity:

Purification Methods:

  • Affinity chromatography utilizing His-tag or Myc-tag engineered into the recombinant protein

  • Size exclusion chromatography for further purification and buffer exchange

  • Ion exchange chromatography to remove contaminants with different charge properties

Characterization Techniques:

  • Physical Characterization:

    • SDS-PAGE to confirm molecular weight and purity (>85% purity standard)

    • Western blotting for immunological confirmation

    • Mass spectrometry for precise molecular weight determination

  • Functional Characterization:

    • Lymphocyte proliferation assay using pig PBMCs to confirm bioactivity

    • Measurement of downstream signaling activation (STAT proteins)

    • Assessment of cytokine induction profiles

  • Structural Characterization:

    • Transmission electron microscopy for nanoparticle formulations

    • Zeta potential measurements for surface charge determination

    • Particle size analysis for nanoparticle preparations

For chitosan nanoparticle-encapsulated IL23A preparations, additional parameters are typically assessed, including average diameter (approximately 109.6 nm) and zeta potential (+24.5 mV), which influence cellular uptake and biodistribution . These comprehensive characterization procedures ensure that the recombinant protein meets quality standards for research applications.

How Can the Bioactivity of Recombinant Pig IL23A Be Measured?

Assessment of recombinant pig IL23A bioactivity requires multiple complementary assays that evaluate different aspects of its immunological functions:

In Vitro Bioactivity Assays:

  • Lymphocyte Proliferation Assay:

    • Isolate pig PBMCs and stimulate with ConA (5 μg/mL) for 24 hours

    • Harvest blast cells and culture with recombinant IL23A

    • After 48 hours incubation, measure proliferation using CCK-8 kit

    • Quantify results by measuring OD450 using a microplate reader

  • Signal Transduction Analysis:

    • Treat responsive cells with recombinant IL23A

    • Measure phosphorylation of STAT1, STAT2, STAT3, and STAT4 by Western blot

    • Assess expression levels of downstream genes (TLR2, TLR7, IL-12) by qRT-PCR

In Vivo Bioactivity Assessment:

  • Cellular Immune Responses:

    • Flow cytometric analysis of CD4+ and CD8+ T cell populations

    • Monitoring of peripheral blood leukocyte and erythrocyte counts

    • Assessment of memory cell markers (CD45, IL-15)

  • Humoral Immune Responses:

    • Measurement of IgG2a levels by ELISA

    • Detection of antigen-specific antibodies (e.g., PCV2 antibodies)

    • Analysis of B cell activation markers

  • Gene Expression Analysis:

    • qRT-PCR measurement of immune-related genes

    • Focus on TLRs, STATs, cytokines, and anti-apoptotic genes (Bcl-2)

    • Use of appropriate housekeeping genes (e.g., PPIA) for normalization

These assays provide a comprehensive evaluation of IL23A bioactivity, reflecting its multiple roles in the immune system. Validation across multiple assays increases confidence in the functional integrity of the recombinant protein.

What Are the Key Applications of Recombinant Pig IL23A in Immunological Research?

Recombinant pig IL23A has emerged as a valuable tool in multiple areas of immunological research:

Vaccine Development Applications:

  • Serves as a potent adjuvant to enhance immune responses to vaccines

  • When encapsulated in chitosan nanoparticles, improves both humoral and cellular immunity to PCV2 vaccines

  • Increases leukocytes, erythrocytes, and T cell populations, enhancing vaccine efficacy

  • Promotes higher levels of specific antibodies and IgG2a after vaccination

Basic Immunology Research Applications:

  • Facilitates study of Th17 cell development and function in porcine systems

  • Enables investigation of cytokine networks in pig immune responses

  • Allows comparative immunology studies between pigs and other species

  • Supports research on immune memory formation and maintenance

Disease Model Applications:

  • Enhances understanding of immune responses to porcine circovirus

  • May provide insights into autoimmune and inflammatory conditions in pigs

  • Serves as a platform for developing novel immunotherapeutic approaches

  • Helps bridge gaps between murine models and human applications

Diagnostic Development:

  • Enables development of ELISA kits for detection of natural and recombinant IL23A

  • Supports creation of research tools for studying IL-23 pathway activation

  • Facilitates monitoring of immune responses in experimental settings

The versatility of recombinant pig IL23A makes it particularly valuable for agricultural research focused on enhancing disease resistance and vaccine efficacy in swine populations, which has significant implications for animal health and productivity.

How Does Pig IL23A Interact with Other Components of the Immune System?

Pig IL23A participates in a complex network of molecular and cellular interactions within the porcine immune system:

Molecular Interactions:

  • Heterodimer Formation:

    • IL23A (p19) forms a heterodimeric complex with IL12B (p40)

    • This interaction is stabilized by a disulfide bond between Cys54 of p19 and Cys177 of p40

    • The heterodimer formation is essential for biological activity

  • Receptor Engagement:

    • The IL-23 complex binds to its receptor (IL-23R) on target cells

    • IL-23R is expressed on various cell types including macrophages, dendritic cells, and T cells

    • Binding initiates JAK-STAT signaling pathways, particularly involving STAT3

Cellular Network Interactions:

  • T Cell Subsets:

    • Promotes expansion and maintenance of Th17 cells

    • Enhances CD4+ and CD8+ T cell responses after vaccination

    • Contributes to memory T cell development through IL-15 and CD45 upregulation

  • Innate Immune Cells:

    • Influences dendritic cell maturation and function

    • Activates innate lymphoid cells (ILC3s)

    • Impacts neutrophil function and recruitment

  • Cytokine Network:

    • Stimulates IL-17A production, a major effector molecule

    • Upregulates expression of IL-12, creating feedback loops

    • Influences IFN-γ production, linking to Th1 responses

Signaling Pathway Engagement:

  • Activates JAK-STAT pathway, particularly STAT1, STAT2, STAT3, and STAT4

  • Influences expression of pattern recognition receptors (TLR2, TLR7)

  • Promotes expression of anti-apoptotic factors like Bcl-2

These interactions highlight the central role of IL23A in coordinating immune responses, particularly at the interface of innate and adaptive immunity. The ability of recombinant IL23A to modulate these interactions makes it a powerful tool for immunomodulation in porcine research.

What Genetic Conservation Patterns Are Observed in IL23A Across Species?

Evolutionary analysis of IL23A reveals remarkable conservation patterns that suggest its critical immunological importance:

Interspecies Conservation:

  • Complete homology of the IL23A mRNA transcript exists between humans and chimpanzees, despite 5-7 million years of evolutionary divergence

  • The evolutionary distance between human IL23A and other species (swine, bovine, rat, mouse) is approximately half that observed for IL12B

  • This exceptional conservation suggests stronger evolutionary pressure to maintain IL23A structure and function compared to related cytokine genes

Intraspecies Variation:

  • A comprehensive sequencing study of the human IL23A gene in 96 individuals from two distinct populations (European and Southern African Bantu) revealed:

    • 33 different DNA variants within the 6.36-kb region screened

    • 22 variants (67%) were previously unreported in databases

    • Most variants (except one at position -1752C>G) were population-specific

Conservation in Coding vs. Regulatory Regions:

  • Both coding and known regulatory regions of IL23A show significant conservation

  • This pattern supports a critical physiological role for IL-23 in immune function

  • Suggests that functional genetic variants within IL23A will have substantial impact on host immune responses

Evolutionary Selection Patterns:

  • Evidence suggests IL23A has undergone positive selection pressure directed toward conservation

  • This unusual pattern of selection highlights the critical balance IL-23 maintains in immune regulation

  • May explain why IL-23 pathway dysregulation is associated with autoimmune disorders in humans

The high degree of conservation observed in IL23A across species provides a strong rationale for using porcine models to study IL-23 biology with potential translatability to human medicine. The selective conservation of this gene throughout mammalian evolution underscores its fundamental importance in immune system function.

How Can Recombinant Pig IL23A Be Used as an Adjuvant in Vaccine Development?

The application of recombinant pig IL23A as a vaccine adjuvant involves sophisticated methodological approaches to enhance immune responses:

Preparation Methodology:

  • Recombinant Plasmid Construction:

    • Clone both IL23A (p19) and IL12B (p40) subunit genes from pig PBMCs

    • Link the genes using the 63bp 2A self-cleaving sequence

    • Add a tissue plasminogen activator (TPA) signal sequence for secretion

    • Subclone into a eukaryotic secretory expression vector (e.g., VR1020)

  • Nanoparticle Formulation:

    • Prepare chitosan solution (2.4 mg/mL in 1% acetic acid, pH 5.5)

    • Add sodium polyphosphate and incubate at 55°C for 20 minutes

    • Gradually add plasmid solution to achieve CS:plasmid ratio of 30:1

    • Characterize nanoparticles for size (~110 nm) and zeta potential (~+24.5 mV)

Administration Protocol:

  • Intramuscular injection of IL23A-CS nanoparticles (0.5 mg/mL, 1.5 mg total)

  • Co-administration with the target vaccine (e.g., PCV2 vaccine)

  • Strategic timing for optimal immune enhancement

  • Monitoring of immune parameters at days 7, 14, 28, 56, and 84 post-inoculation

Adjuvant Mechanisms:

Immune ComponentEffect of IL23A AdjuvantMeasurement MethodReference
Humoral ImmunityIncreased IgG2a and antigen-specific antibodiesELISA
Cellular ImmunityEnhanced CD4+ and CD8+ T cell populationsFlow cytometry
Innate ImmunityUpregulation of TLR2 and TLR7qRT-PCR
Immune MemoryIncreased CD45 and IL-15 expressionqRT-PCR
Signaling PathwaysActivation of STAT1, STAT2, STAT3, and STAT4qRT-PCR

Efficacy Parameters:

  • Besides enhanced immune responses, IL23A adjuvant demonstrated tangible benefits:

    • Improved weight gain (37.50 ± 2.41 kg vs. 30.98 ± 4.25 kg in control)

    • Better feed conversion ratio (2.40 vs. 2.97 in control)

    • No adverse effects on animal health

This comprehensive approach to using IL23A as an adjuvant demonstrates its potential to significantly enhance both the efficacy and efficiency of swine vaccines, potentially reducing the need for antibiotic use in livestock production while improving animal health and productivity.

What Methodological Considerations Are Important When Using Recombinant Pig IL23A in In Vivo Studies?

Designing robust in vivo studies with recombinant pig IL23A requires careful attention to multiple methodological aspects:

Experimental Design Considerations:

  • Animal Selection and Preparation:

    • Screen animals for pre-existing infections that could confound results (PCV2, PCV3, mycoplasma, CSFV, PRRSV)

    • Consider age-appropriate models (e.g., 21-day-old piglets for vaccination studies)

    • Account for breed differences in immune responses (Tibetan pigs vs. commercial breeds)

    • Randomize animals appropriately into experimental and control groups

  • Delivery System Optimization:

    • Plasmid-based expression vs. direct protein administration

    • Nanoparticle formulation parameters (size, zeta potential, chitosan:plasmid ratio)

    • Route of administration (intramuscular injection preferred for vaccine studies)

    • Dosage determination (1.5 mg recombinant plasmids at 0.5 mg/mL concentration has shown efficacy)

  • Control Selection:

    • Appropriate vehicle controls (saline or empty vector encapsulated in chitosan)

    • Positive controls where applicable (known adjuvants)

    • Matched experimental conditions between groups

Monitoring Parameters:

Parameter TypeSpecific MeasurementsSampling TimepointsMethods
HematologicalLeukocytes, erythrocytes, platelets, hemoglobinDays 7, 14, 35, 84Automated analyzer
Cellular ImmunityCD4+ and CD8+ T cellsDays 35, 56, 84Flow cytometry
Humoral ImmunityIgG2a, antigen-specific antibodiesDays 7-84ELISA
Gene ExpressionTLRs, cytokines, STATs, Bcl-2Days 7, 14, 35, 56, 84qRT-PCR
PhysiologicalWeight gain, feed conversionThroughout studyStandard measurement

Technical Challenges to Address:

  • Ensuring proper co-expression of both IL23A and IL12B subunits

  • Maintaining plasmid integrity during nanoparticle preparation

  • Controlling for individual variation in immune responses

  • Balancing immune enhancement without triggering excessive inflammation

Ethical and Regulatory Considerations:

  • Adherence to institutional animal ethics committee guidelines

  • Appropriate housing and management conditions

  • Minimizing animal numbers while maintaining statistical power

  • Limiting distress during sample collection procedures

These methodological considerations are critical for generating reliable and reproducible data when studying the immunomodulatory effects of recombinant pig IL23A in vivo, particularly for applications in vaccine development and disease resistance enhancement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.