Recombinant Pig Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATLAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

Recombinant Pig Inward rectifier potassium channel 2 (KCNJ2) likely plays a role in establishing action potential waveform and excitability in neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater influx of potassium ions compared to efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification is primarily due to intracellular magnesium blockage. The channel is sensitive to blockade by extracellular barium and cesium.

Database Links

KEGG: ssc:397293

UniGene: Ssc.15965

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.

Q&A

What are the functional characteristics of KCNJ2 channels?

KCNJ2 channels exhibit strong inward rectification, allowing potassium ions to flow into the cell more readily than out of the cell. This rectification is primarily mediated by intracellular Mg²⁺ and polyamines (spermine and spermidine) that physically block the channel pore at depolarized membrane potentials .

Key functional characteristics include:

  • Inward rectification at membrane potentials positive to the potassium equilibrium potential (EK)

  • Single-channel conductance of approximately 20-35 pS (depending on the specific Kir2.x subtype)

  • Regulation by phosphatidylinositol 4,5-bisphosphate [PtdIns(4,5)P₂]

  • Modulation by intracellular pH and phosphorylation

Experimental data shows that rectification can be eliminated by reducing intracellular Mg²⁺ to less than 1 μM and restored by adding approximately 1 mM Mg²⁺, demonstrating the critical role of magnesium in channel function .

What expression systems are optimal for producing functional recombinant pig KCNJ2?

For recombinant pig KCNJ2 expression, several systems have been successfully employed, each with specific advantages:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, suitable for structural studiesLimited post-translational modifications, protein may require refoldingProtein production for antibody generation, structural studies
Xenopus oocytesNative-like membrane environment, suitable for electrophysiological recordingsLower throughput, seasonal variation in oocyte qualityElectrophysiological characterization, mutational analysis
Mammalian cell lines (HEK293, CHO)Proper post-translational modifications, formation of functional channelsLower protein yield, higher costFunctional studies, drug screening, protein-protein interactions

When expressing recombinant pig KCNJ2 in E. coli, optimal results are achieved using an N-terminal His tag, with protein purified under conditions that maintain proper folding . For functional studies, reconstitution in lipid bilayers or expression in mammalian cells is recommended to preserve native channel properties.

What methods are most effective for evaluating KCNJ2 channel function?

Multiple complementary approaches can be used to assess KCNJ2 channel function:

For comprehensive characterization, combining these methods is recommended. For example, a recent study combined patch-clamp experiments with computational molecular modeling to investigate the atomic-level mechanisms underlying Andersen-Tawil syndrome-associated mutations .

How do pig KCNJ2 channels compare to native inward rectifier K+ channels in other species?

Studies comparing cloned Kir2 channels with native inward rectifier channels have revealed important insights across species:

  • Conductance properties:

    • Guinea pig cardiomyocytes show three distinct inward rectifier channel populations: large-conductance (34.0 pS), intermediate-conductance (23.8 pS), and low-conductance (10.7 pS) channels

    • The large-conductance channels correspond functionally to gpKir2.2, while intermediate and low-conductance channels may correspond to gpKir2.1 and gpKir2.3, respectively

  • Pharmacological sensitivity:

    • Ba²⁺ block of large-conductance inward rectifier channels in guinea pig cardiomyocytes shows virtually identical concentration and voltage dependence to that of gpKir2.2 expressed in Xenopus oocytes

    • This pharmacological profile provides a useful tool for distinguishing between different Kir2.x subtypes across species

  • Gating kinetics:

    • Time-dependent properties of rectification vary among species

    • Polyamine-mediated block shows species-specific kinetics, which may reflect differences in channel structure or in the intracellular milieu

These comparative studies help establish the pig KCNJ2 as a valuable model for understanding human channel function, given the conservation of key functional domains across mammalian species.

How can recombinant pig KCNJ2 be used to model human channelopathies?

Recombinant pig KCNJ2 provides a valuable platform for modeling human channelopathies due to high homology with human KCNJ2. Key approaches include:

  • Mutation analysis:

    • Introduction of disease-associated mutations (e.g., R67W, R67Q, R218L, G300D) into pig KCNJ2 to study their effects on channel function

    • Comparison of homomeric versus heteromeric channel properties to understand dominant-negative effects

  • Cellular electrophysiology:

    • Patch-clamp studies of mutant channels can reveal specific functional defects

    • Recent investigations of Andersen-Tawil syndrome mutations showed loss of function in homomeric mutant channels, with dominant-negative effects on wild-type subunits

  • In vivo modeling:

    • Lentiviral vector-mediated expression of mutant KCNJ2 in animal models

    • RNA interference approaches to modulate channel expression

    • These techniques have demonstrated that inhibition of KCNJ2 expression can increase ventricular rate in rat models

What are the critical considerations when interpreting patch-clamp data from mutant KCNJ2 channels?

When analyzing electrophysiological data from mutant KCNJ2 channels, researchers should consider several important factors:

How do PtdIns(4,5)P₂ interactions modulate KCNJ2 function and how can this be studied?

PtdIns(4,5)P₂ is a critical regulator of KCNJ2 channel function. Advanced methodologies to study this interaction include:

  • Site-directed mutagenesis:

    • Mutations affecting PtdIns(4,5)P₂ binding strength (e.g., Kir2.1(R312Q) and Kir2.3(I213L)) can be introduced to weaken or strengthen channel-PtdIns(4,5)P₂ binding, respectively

    • Comparison of mutant channels reveals that inhibition induced by phospholipase C, protein kinase C, lipid phosphatases, and protons correlates inversely with channel affinity for PtdIns(4,5)P₂

  • Lipid biochemistry approaches:

    • Direct binding assays using purified channel protein and fluorescently labeled PtdIns(4,5)P₂

    • Reconstitution in artificial lipid bilayers with defined PtdIns(4,5)P₂ content

  • Fluorescence techniques:

    • FRET-based assays to monitor real-time changes in channel-PtdIns(4,5)P₂ interactions

    • Confocal microscopy to visualize co-localization with PtdIns(4,5)P₂-rich membrane domains

  • Computational modeling:

    • Molecular dynamics simulations to identify key residues involved in PtdIns(4,5)P₂ binding

    • Docking studies to predict binding modes and energetics

Understanding these interactions is particularly important because they may represent a convergence point for multiple regulatory pathways, including phosphorylation and pH-dependent modulation.

What molecular mechanisms underlie the differential phenotypic expression of KCNJ2 mutations in cardiac versus skeletal muscle?

KCNJ2 mutations can affect multiple tissues, resulting in cardiac arrhythmias, periodic paralysis, and developmental abnormalities. The tissue-specific manifestations involve complex mechanisms:

  • Differential gene expression:

    • Varying expression levels of KCNJ2 and other Kir family members across tissues

    • Compensatory upregulation of other channels may occur in a tissue-specific manner

  • Tissue-specific protein interactions:

    • Different auxiliary proteins and regulatory molecules in cardiac versus skeletal muscle

    • The R67W mutation identified in Andersen-Tawil syndrome suggests that KCNJ2 plays a role in developmental signaling beyond its electrophysiological function

  • Sex-specific differences:

    • KCNJ2 mutations described in CPVT-like phenotypes are predominantly reported in females

    • Age of onset or diagnosis ranges from 2 to 36 years (mean approximately 15 years) compared to 8 years for RYR2-related CPVT

  • ECG characteristics:

    • KCNJ2-mutated patients show distinctive ECG patterns, including:

      • Biphasic and enlarged U-waves that increase in amplitude during tachycardia

      • Prolonged terminal T downslope

      • Wide T-U junctions

      • Fusion of T and U waves after PVC

      • U on P sign during sinus tachycardia

  • Response to exercise:

    • In KCNJ2-mutated patients, ventricular arrhythmias appear early, stop at peak exercise, and reappear after exercise

    • This pattern differs from other CPVT patients, where arrhythmias increase to maximum at peak exercise

Understanding these differential mechanisms is crucial for developing targeted therapeutic approaches for specific KCNJ2-related disorders.

How can gene editing technologies be applied to study KCNJ2 function and develop potential therapeutics?

Emerging gene editing technologies offer powerful approaches for KCNJ2 research:

  • CRISPR/Cas9 applications:

    • Creation of isogenic cell lines with specific KCNJ2 mutations

    • Generation of animal models with precise mutations corresponding to human channelopathies

    • Correction of disease-causing mutations in patient-derived cells

  • RNA interference strategies:

    • Lentiviral vector-based shRNA delivery systems have been successfully used to suppress KCNJ2 expression

    • Studies show optimal virus titer for lentiviral vector transfection in rat is 1 × 10⁹ TU/mL

    • After transfection, KCNJ2 mRNA levels can be reduced by approximately 77%, with stable interference from day 7 post-transfection

    • Corresponding Kir2.1 protein expression can be inhibited by approximately 55%

  • Therapeutic potential:

    • For loss-of-function disorders like Andersen-Tawil syndrome, gene therapy approaches aimed at enhancing wild-type KCNJ2 expression

    • For gain-of-function disorders, antisense oligonucleotides or RNA interference to selectively reduce expression of mutant alleles

These advanced genetic approaches provide unprecedented precision in modulating KCNJ2 function, potentially leading to novel therapeutic strategies for channelopathies.

What are the structural determinants of polyamine and Mg²⁺ binding that govern KCNJ2 rectification?

The molecular basis of inward rectification involves complex interactions between the channel pore and intracellular blocking molecules:

Understanding these structural determinants could guide the development of targeted modulators of KCNJ2 function with potential therapeutic applications in cardiac arrhythmias and other channelopathies.

What are the optimal storage and handling conditions for recombinant pig KCNJ2 protein?

For maintaining protein stability and activity, follow these research-validated guidelines:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of glycerol (5-50% final concentration) is recommended for long-term storage at -20°C/-80°C

    • The default final concentration of glycerol is 50%

  • Buffer considerations:

    • Optimal storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

    • For functional studies, consider buffers that maintain physiological ion concentrations and pH

  • Quality control:

    • Verify protein purity (>90%) by SDS-PAGE before experimental use

    • Assess functionality through binding assays or reconstitution in lipid bilayers

These handling protocols are critical for ensuring reproducible results in structure-function studies of recombinant pig KCNJ2.

What are the key considerations for designing KCNJ2 mutagenesis experiments to study channel function?

When designing mutagenesis experiments to investigate KCNJ2 function, consider these research-based recommendations:

  • Mutation selection strategy:

    • Target conserved residues across species for studying fundamental channel properties

    • Focus on disease-associated mutations (e.g., R67W, R67Q, R218L, G300D) to understand pathophysiological mechanisms

    • Consider creating corresponding mutations to those identified in homologous channels with known effects

  • Expression system considerations:

    • Use mammalian expression systems for functional studies to ensure proper post-translational modifications

    • Consider co-expression with wild-type subunits at different ratios to assess dominant-negative effects

    • Include positive controls (wild-type channels) and negative controls (non-functional mutants)

  • Functional characterization approach:

    • Apply consistent voltage protocols across experiments for reliable comparison

    • Design specific protocols to isolate the property of interest (e.g., rectification, PtdIns(4,5)P₂ sensitivity)

    • Use multiple complementary approaches (electrophysiology, biochemistry, imaging) for comprehensive characterization

  • Data analysis framework:

    • Quantify multiple parameters (current density, rectification index, kinetics) to fully characterize mutant channels

    • Apply appropriate statistical methods for comparing mutant and wild-type channels

    • Consider computational modeling to predict structural consequences of mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.