Recombinant Pig L-gulonolactone oxidase (GULO)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig L-Gulonolactone Oxidase (GULO)

L-gulonolactone oxidase (GULO) is an enzyme that is essential for the synthesis of L-ascorbic acid (Vitamin C) in most mammals . GULO belongs to the family of aldonolactone oxidoreductases (AlORs) and contains two conserved domains: an N-terminal FAD-binding region and a C-terminal HWXK motif capable of binding the flavin cofactor . Humans and guinea pigs cannot synthesize Vitamin C due to mutations in the GULO gene, which have led to its pseudogenization (the conversion of a functional gene into a non-functional pseudogene) .

Recombinant GULO refers to GULO that is produced using recombinant DNA technology, where the GULO gene from one organism (in this case, a pig) is expressed in a different host organism (e.g., bacteria, yeast, or mammalian cells) to produce the enzyme . The recombinant form of GULO can be used for research purposes, such as studying its enzymatic activity, structure, and potential applications in biotechnology and medicine .

Production of Recombinant Pig GULO

Recombinant GULO can be produced in various expression systems, each with its own advantages and challenges .

Enzymatic Activity and Characterization

The enzymatic activity of recombinant GULO can be assessed using various methods, including GULO activity assays and in-gel staining for GULO activity . These assays measure the rate at which GULO catalyzes the conversion of L-gulono-γ-lactone to L-ascorbic acid .

Factors Affecting Enzyme Activity:

  • pH: The optimal pH for GULO activity varies depending on the source of the enzyme. For example, the optimal activities of recombinant full-length rat GULO (fGULO) and its C-terminal catalytic domain (cGULO) were observed at pH 7 and 6.5, respectively . The enzymatic activity of GULO generally increases in the acidic range of pH 3.0 to 6.0 and decreases in the alkaline range of pH 7.5 to 9.5 .

  • Temperature: The optimal temperature for GULO activity also varies. The optimal temperatures for fGULO and cGULO were found to be 40 °C and 30 °C, respectively .

  • Substrate Concentration: Kinetic studies have shown that the Michaelis constant (KmK_m) values for fGULO and cGULO at low substrate concentrations were 53.5 ± 5 µM and 42 ± 6.3 µM, respectively .

Applications of Recombinant Pig GULO

Recombinant GULO has several potential applications in research, biotechnology, and medicine:

  • Vitamin C Production: Recombinant GULO can be used to produce Vitamin C in vitro or in vivo . For example, expressing murine Gulo in human cells can rescue the Vitamin C biosynthesis pathway .

  • Gene Therapy: Adenoviral vectors expressing murine Gulo have been used to increase serum Vitamin C levels in Gulo knockout mice, which are unable to synthesize Vitamin C .

  • Transgenic Animal Models: Ongoing research focuses on using lentivirus vectors to express murine Gulo in guinea pigs, which, like humans, cannot synthesize Vitamin C. This approach has been shown to extend the lives of guinea pigs maintained on a Vitamin C-free diet .

  • Understanding GULO Function: Creating recombinant versions of GULO allows scientists to study the structure, function, and regulation of GULO in more detail .

Table: Recombinant Pig L-Gulonolactone Oxidase (GULO) Products

CodeSourceConjugate
CSB-YP811552PI1YeastN/A
CSB-EP811552PI1E. coliN/A
CSB-EP811552PI1-BE. coliAvi-tag Biotinylated (E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.)
CSB-BP811552PI1BaculovirusN/A
CSB-MP811552PI1Mammalian cellN/A

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize developing the specified tag.
Synonyms
GULO; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-440
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
GULO
Target Protein Sequence
VHGHKGVKFQNWAKTYGCCPEMYYQPTSVEEIREVLALARQQNKRVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLKVDMEKKQVTVEAGILLADLHPQLDKHGLALSNLGAVSDVTAGGV IGSGTHNTGIKHGILATQVVELTLLTPDGTVLVCSESSNAEVFQAARVHLGCLGVILTVT LQCVPQFHLQETTFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSVIYQDHTNKPPSS SANWFWDYAIGFYLLEFLLWISTFVPGLVGWINRFFFWLLFNGKKENCNLSHKIFTYECR FKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRADDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKVGGRPHWAKAHNCTRKDFEKMYPAFRKFCAIR EKLDPTGMFLNAYLEKVFY
Uniprot No.

Target Background

Function
Oxidizes L-gulono-1,4-lactone to hydrogen peroxide and L-xylo-hexulonolactone, which spontaneously isomerizes to L-ascorbate.
Database Links
Protein Families
Oxygen-dependent FAD-linked oxidoreductase family
Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is L-gulonolactone oxidase (GULO) and why is it significant in comparative biology?

L-gulonolactone oxidase (GULO) is an enzyme that catalyzes the final step in L-ascorbic acid (vitamin C) biosynthesis. This enzymatic activity has been lost in primates, including humans, necessitating dietary intake of vitamin C to prevent scurvy. The significance of GULO lies in understanding evolutionary patterns of gene degradation and metabolic pathway losses across species. Loss of the vitamin C pathway due to deletions in the GULO gene has been detected in humans, apes, guinea pigs, bats, mice, rats, pigs, and passerine birds, making it an important model for studying genetic entropy and evolutionary biology .

Methodologically, comparative genomic analysis of GULO genes and pseudogenes across species requires careful sequence alignment techniques, consideration of transposable element fragments that may contribute to deletion events, and phylogenetic analysis to determine independent versus shared mutation events.

How does porcine GULO structure and function compare with GULO from other species?

Porcine GULO shares structural and functional similarities with GULO from other mammals, but with species-specific variations. While complete structural characterization of pig GULO has not been fully documented in the provided literature, research on rat GULO variants offers valuable comparative insights.

Studies on rat GULO have demonstrated that both full-length (fGULO) and C-terminal catalytic domain (cGULO) variants maintain biological activity. The C-terminal domain appears to be the primary catalytic region, with optimal activities observed at specific pH and temperature conditions (pH 7.0 and 40°C for fGULO; pH 6.5 and 30°C for cGULO) . Similar domain organization would be expected in porcine GULO.

From an experimental perspective, researchers should consider that while pigs naturally express functional GULO (unlike humans), recombinant expression allows for protein engineering, improvement of catalytic properties, and detailed structure-function analysis.

What expression systems are most effective for producing recombinant pig GULO?

Bacterial Expression Systems:

  • Advantages: Cost-effective, high yield, rapid production

  • Limitations: Potential misfolding, lack of post-translational modifications

  • Example: E. coli has been successfully used to produce both full-length rat GULO and its C-terminal catalytic domain

Mammalian Expression Systems:

  • Advantages: Proper protein folding and post-translational modifications

  • Limitations: Higher cost, slower production, lower yield

Plant-Based Expression Systems:

  • Advantages: Scalability, proper folding, cost-effectiveness for large-scale production

  • Limitations: Longer production time, potential glycosylation differences

When selecting an expression system, researchers should consider that the C-terminal catalytic domain of GULO appears to be more efficiently produced in bacterial systems than the full-length protein, which may inform construct design strategies for pig GULO expression .

What are the recommended protocols for assaying recombinant pig GULO activity?

GULO activity can be assessed using several established protocols, with adaptations required for recombinant pig GULO analysis:

Standard GULO Activity Assay:

  • Prepare reaction mixture containing:

    • 50 mM potassium phosphate buffer (pH 7.0)

    • 50 mM sodium citrate

    • 1 mM dithiothreitol

    • 10 μM FAD

    • Recombinant GULO enzyme

  • Initiate reaction by adding 2.5 mM L-gulono-γ-lactone as substrate

  • Incubate under aerobic conditions at 37°C with vigorous shaking for 15 minutes

  • Terminate reaction with trichloroacetic acid (final concentration 5%)

  • Centrifuge at 15,000×g to remove precipitated proteins

In-gel Activity Staining:
This complementary approach allows visualization of GULO activity directly within a native polyacrylamide gel, providing information about enzyme integrity and oligomeric state simultaneously with activity.

When conducting these assays, it is critical to include appropriate controls, such as samples without substrate or enzyme, to account for background reactions. Researchers should also consider optimizing reaction conditions specifically for pig GULO, as optimal temperatures and pH may differ from the rat enzyme parameters (pH 7.0, 40°C for fGULO; pH 6.5, 30°C for cGULO) .

How can genetic engineering techniques be optimized for modifying pig GULO expression?

Modern genetic engineering of pig GULO can be accomplished through several approaches, with CRISPR/Cas9 emerging as the most efficient method:

CRISPR/Cas9 Genome Editing:

  • Design guide RNAs (gRNAs) targeting specific regions of the pig GULO gene

  • Introduce CRISPR/Cas9 components along with donor DNA templates (if performing knockin)

  • Screen for successful edits using PCR, sequencing, or functional assays

  • Generate founder animals through embryo modification or somatic cell nuclear transfer (SCNT)

Somatic Cell Nuclear Transfer (SCNT):

  • Modify pig fibroblasts using CRISPR/Cas9 or other gene editing techniques

  • Replace nuclei in porcine oocytes with nuclei from modified fibroblasts

  • Develop reconstructed embryos and transfer to surrogate sows

  • Screen resulting offspring for desired genetic modifications

The efficiency of GULO modification can be enhanced by:

  • Using multiple gRNAs to target different GULO exons simultaneously

  • Employing homology-directed repair for precise modifications

  • Screening large numbers of edited cells before SCNT to increase success rates

For researchers studying GULO function, conditional knockout systems may be preferable to complete gene deletion, allowing for temporal control of GULO expression and avoiding complications from complete vitamin C deficiency in the animals.

What purification strategies yield the highest activity for recombinant pig GULO?

Purification of recombinant pig GULO requires careful consideration of protein structure and biochemical properties. Based on studies with rat GULO, the following strategies are recommended:

Affinity Chromatography:

  • His-tag purification has been successfully employed for both full-length and C-terminal domain variants of rat GULO

  • Careful buffer optimization is essential to maintain FAD cofactor association and enzyme activity

Multi-step Purification Protocol:

  • Initial capture using affinity chromatography (e.g., His-tag)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography to ensure homogeneity

Critical Considerations:

  • Maintain reducing conditions throughout purification to protect critical thiol groups

  • Include FAD in buffers to prevent cofactor dissociation

  • Monitor activity at each purification step to track yield and specific activity

  • Consider using the C-terminal catalytic domain for higher expression efficiency and easier purification

Researchers should note that protein yield and specific activity data from rat GULO studies suggest that the C-terminal domain may be advantageous for applications requiring larger amounts of purified enzyme.

How can recombinant pig GULO be utilized in xenotransplantation research?

Recombinant pig GULO has potential applications in xenotransplantation research, particularly in creating genetically modified pigs for organ donation to humans:

GULO Expression in Xenotransplantation:

  • Since humans lack functional GULO, pig organs expressing GULO could potentially provide local vitamin C production in the transplanted organ

  • This could enhance tissue resilience through antioxidant protection during the stressful transplantation process

Integration with Other Genetic Modifications:
Optimal xenotransplantation organ-source pigs typically require multiple genetic modifications, including:

  • Deletion of xenoantigens (e.g., GTKO, β4GalNT2KO, CMAHKO)

  • Addition of human complement-regulatory proteins

  • Addition of human coagulation-regulatory proteins

GULO expression or modification could be incorporated into these multi-gene-edited pigs through CRISPR/Cas9 technology with SCNT . When designing such experiments, researchers should consider potential interactions between GULO expression and other genetic modifications, particularly those affecting immune and inflammatory responses.

What are the key challenges in maintaining enzymatic activity of recombinant pig GULO during storage and experimental use?

Maintaining GULO activity presents several challenges due to the enzyme's biochemical properties:

Cofactor Retention:

  • GULO requires FAD as a cofactor for activity

  • Protocols should include FAD supplementation during purification and storage

  • Monitor FAD:protein ratio spectrophotometrically

Oxidative Sensitivity:

  • As an oxidase, GULO is ironically sensitive to oxidative damage

  • Storage buffers should include reducing agents (e.g., DTT, β-mercaptoethanol)

  • Consider adding glycerol (20-30%) to prevent freeze-thaw damage

Temperature Stability:
Based on rat GULO studies, the enzyme exhibits temperature-dependent activity profiles:

  • Full-length GULO: optimal activity at 40°C

  • C-terminal domain: optimal activity at 30°C

These temperature profiles suggest differences in structural stability that should inform storage conditions and experimental design.

Stability Improvement Strategies:

  • Site-directed mutagenesis to enhance thermostability

  • Formulation optimization (pH, ionic strength, excipients)

  • Protein engineering to create more stable variants

  • Immobilization on solid supports for specific applications

Researchers should systematically evaluate these factors when working with recombinant pig GULO to ensure consistent enzyme performance across experiments.

What insights can be gained from studying recombinant pig GULO in relation to human GULO pseudogene research?

Studying recombinant pig GULO offers valuable comparative insights for human GULO pseudogene research:

Evolutionary Insights:

  • Humans possess a GULO pseudogene with multiple exon losses

  • Comparative analysis of functional pig GULO with the human pseudogene can reveal the molecular basis for vitamin C synthesis loss in primates

  • Research suggests that GULO exon losses in humans, chimpanzees, and gorillas occurred independently, not supporting simple common ancestry models

Structure-Function Relationships:

  • Recombinant pig GULO allows structure-function studies not possible with the non-functional human pseudogene

  • Chimeric constructs combining pig GULO domains with human pseudogene sequences can identify critical functional regions

Genetic Engineering Applications:

  • Understanding pig GULO function could inform potential therapeutic strategies targeting vitamin C metabolism

  • The human GULO region shows only 84% and 87% identity compared to chimpanzee and gorilla, respectively, challenging common assumptions about evolutionary relationships

This research area requires sophisticated genomic analysis techniques, including:

  • Comparative sequence analysis across species

  • Structural modeling of functional and non-functional GULO variants

  • Functional complementation studies

  • Evolutionary rate analysis of GULO sequence changes

What kinetic parameters characterize recombinant pig GULO and how do they compare with GULO from other species?

Understanding the kinetic parameters of recombinant pig GULO is essential for comparative enzymology and optimization of experimental conditions:

Key Kinetic Parameters:
While specific pig GULO kinetic data is not provided in the search results, comparative data from rat GULO variants provide a relevant reference point:

ParameterRat fGULORat cGULOPig GULO (estimated)
Km (μM)53.5 ± 5.042.0 ± 6.345-55 (expected range)
Optimal pH7.06.56.5-7.0 (expected range)
Optimal temperature (°C)403037-40 (expected range)
CofactorFADFADFAD

The lower Km value for the C-terminal domain (cGULO) compared to the full-length enzyme (fGULO) suggests higher substrate affinity in the catalytic domain alone . Researchers working with pig GULO should perform detailed kinetic characterization to establish precise parameters for their specific recombinant constructs.

Methodological Approaches:

  • Steady-state kinetics using varying substrate concentrations

  • Determination of Km and Vmax through Lineweaver-Burk or Eadie-Hofstee plots

  • Inhibition studies to identify regulatory mechanisms

  • pH and temperature profiling to optimize reaction conditions

These kinetic studies should be conducted under standardized conditions to enable meaningful cross-species comparisons.

How can researchers troubleshoot common issues in recombinant pig GULO expression and activity assays?

When working with recombinant pig GULO, researchers may encounter several challenges that require systematic troubleshooting:

Low Expression Yields:

  • Optimize codon usage for expression system

  • Test different promoter strengths

  • Evaluate different host strains/cell lines

  • Consider expressing the C-terminal domain instead of full-length protein, as it shows better production efficiency in bacterial systems

  • Adjust induction conditions (temperature, inducer concentration, duration)

Poor Enzymatic Activity:

  • Ensure FAD cofactor availability

  • Verify protein folding through circular dichroism or fluorescence spectroscopy

  • Check for inhibitory compounds in buffers

  • Optimize assay conditions (pH, temperature, substrate concentration)

  • Consider the optimal conditions observed for rat GULO variants (pH 7.0, 40°C for fGULO; pH 6.5, 30°C for cGULO)

Inconsistent Assay Results:

  • Standardize substrate quality and preparation

  • Implement rigorous quality control for reagents

  • Include appropriate controls in each assay

  • Consider using multiple detection methods to cross-validate results

Protein Instability:

  • Optimize buffer composition

  • Add stabilizing agents (glycerol, reducing agents)

  • Evaluate storage conditions systematically

  • Consider protein engineering to enhance stability

By methodically addressing these issues, researchers can improve the reliability and reproducibility of their recombinant pig GULO studies.

What are the best practices for designing experiments comparing recombinant pig GULO with GULO from other species?

Comparative studies of GULO from different species require careful experimental design:

Construct Design Considerations:

  • Generate comparable constructs across species (full-length vs. domain-specific)

  • Standardize tags and fusion partners

  • Consider codon optimization for the chosen expression system

  • Include flexible linkers where appropriate for fusion proteins

Expression and Purification Standardization:

  • Use identical expression systems for all GULO variants

  • Apply consistent purification protocols

  • Verify protein integrity through SDS-PAGE and mass spectrometry

  • Quantify protein concentration using multiple methods

Activity Assay Standardization:

  • Perform assays under identical conditions where possible

  • If optimal conditions differ between species, perform cross-comparison under both sets of conditions

  • Use consistent substrate batches and preparation methods

  • Include internal standards to normalize between experimental runs

Data Analysis Approaches:

  • Apply uniform statistical methods across all comparisons

  • Generate complete kinetic profiles rather than single-point measurements

  • Conduct thermal and pH stability profiles for all variants

  • Use multiple analytical techniques to confirm findings

By implementing these best practices, researchers can ensure that observed differences between pig GULO and other species' GULO enzymes reflect genuine biological variation rather than methodological inconsistencies.

What emerging technologies could enhance recombinant pig GULO research?

Several cutting-edge technologies offer new opportunities for advancing recombinant pig GULO research:

Directed Evolution Approaches:

  • Random mutagenesis coupled with high-throughput screening

  • PACE (Phage-Assisted Continuous Evolution) for rapid enzyme optimization

  • Computational design followed by experimental validation

Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for high-resolution structural determination

  • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

  • AlphaFold2 and other AI-based structure prediction tools

Genome Engineering Technologies:

  • Base editing for precise nucleotide changes without double-strand breaks

  • Prime editing for even more controlled genetic modifications

  • CRISPR activation/interference for studying GULO regulation

Single-Cell Analysis Applications:

  • Tracking GULO expression heterogeneity in engineered cell populations

  • Correlating GULO activity with cellular phenotypes

  • Spatial transcriptomics to understand GULO expression patterns in tissues

These technologies could enable more sophisticated studies of GULO function, regulation, and potential applications in both basic research and biotechnological contexts.

How might comparative analysis of pig GULO with non-functional GULO in primates contribute to evolutionary biology?

Comparative analysis of functional pig GULO with non-functional primate GULO pseudogenes provides unique opportunities for evolutionary research:

Molecular Evolution Insights:

  • Detailed sequence comparison reveals independent GULO exon losses in humans, chimpanzees, and gorillas

  • These patterns challenge certain aspects of common ancestry models

  • The 28,800 base human GULO region shows only 84% and 87% identity compared to chimpanzee and gorilla respectively

Pseudogene Formation Mechanisms:

  • GULO degradation appears associated with transposable element fragments

  • Deletion events likely occurred via unequal recombination

  • Similar mechanisms may apply to other pseudogenes

Taxonomic Distribution Patterns:

  • GULO functionality loss appears in diverse taxonomic groups (primates, guinea pigs, some bats, passerine birds)

  • These patterns represent examples of convergent genetic loss

  • Understanding why certain species could tolerate GULO loss provides insights into dietary adaptation

Methodological Approaches:

  • Phylogenetic analysis using maximum likelihood and Bayesian methods

  • Molecular clock studies to date pseudogenization events

  • Functional complementation experiments using recombinant pig GULO

  • Comparative genomics across multiple species with varying GULO functionality

This research area highlights how studying functional enzymes in one species can illuminate evolutionary processes in related species where gene function has been lost.

What potential applications exist for engineered variants of recombinant pig GULO?

Engineered recombinant pig GULO variants offer numerous potential applications in research and biotechnology:

Improved Vitamin C Production Systems:

  • Engineered GULO with enhanced catalytic efficiency or stability

  • Immobilized enzyme systems for continuous vitamin C production

  • Cell-free biocatalytic systems utilizing optimized GULO variants

Xenotransplantation Applications:

  • Genetically modified pigs expressing enhanced GULO variants

  • Integration with other genetic modifications for optimized donor organs

  • Localized vitamin C production to improve transplant outcomes

Model Systems for Studying Vitamin C Metabolism:

  • Cell lines with controllable GULO expression

  • Humanized animal models with regulatable GULO activity

  • In vitro reconstitution of the vitamin C biosynthetic pathway

Protein Engineering Targets:

  • Altered substrate specificity for production of vitamin C derivatives

  • Temperature or pH tolerance modifications for industrial applications

  • Fusion proteins combining GULO with other enzymatic activities

Each of these applications would require careful protein engineering approaches, including rational design based on structural information, directed evolution for desired properties, and thorough characterization of the resulting variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.