Recombinant Pig Leukocyte surface antigen CD47 (CD47)

Shipped with Ice Packs
In Stock

Description

CD47-SIRPα Signaling Pathway

  • Mechanism: CD47 binds SIRPα on phagocytes, delivering a "don’t eat me" signal to inhibit phagocytosis .

  • Species Incompatibility: Porcine CD47 fails to bind human SIRPα effectively due to low homology, leading to rapid phagocytosis of xenogeneic cells .

  • Human CD47 Rescue: Transgenic expression of human CD47 in pig cells restores SIRPα-mediated inhibition of phagocytosis .

Experimental Validation

Target CellsCD47 ExpressionPhagocytosis Rate (%)Source
Porcine LCL (wild-type)Low (porcine)80–90
Porcine LCL (human CD47 transgenic)High (human)10–20
PAOC/CD47 null (pig)None85–95
PAOC/CD47 null + hCD47 cross-dressingHuman CD4715–25

Beyond Phagocytosis Inhibition

  • Dendritic Cell Modulation: CD47-SIRPα interaction suppresses DC maturation and antigen presentation, enhancing immune tolerance .

  • Apoptosis Regulation: Ligation of endogenous CD47 can induce apoptosis in T cells, while cross-dressed CD47 does not transmit harmful signals .

Transgenic Pig Models

  • Human CD47 Transgenic Pigs: Engineered pigs expressing human CD47 show reduced macrophage-mediated xenograft rejection in nonhuman primates .

  • Combination Strategies: Human CD47 transgenesis is often paired with HLA class I deletion to generate hypoimmunogenic pluripotent stem cells .

CD47 Cross-Dressing as an Alternative

  • Mechanism: EVs from human CD47-overexpressing cells transfer CD47 to pig cells, enabling transient SIRPα binding without genetic modification .

  • Advantages:

    • Avoids risks of CD47 overexpression (e.g., thrombospondin-mediated cell dysfunction) .

    • Effective in both allogeneic and xenogeneic settings .

Comparative Efficacy

ApproachPhagocytosis Inhibition (%)Signal Transmission RiskSource
Transgenic hCD4780–90High (apoptosis)
CD47 Cross-Dressing70–85Low

Expression Thresholds

  • Critical Levels: Transgenic cells require high human CD47 expression (comparable to human PBMCs) to inhibit phagocytosis effectively .

  • Tissue-Specific Variability: Vascular endothelial cells with hCD47 overexpression may exhibit increased permeability and edema in xenografts .

Species-Specific Interactions

  • Porcine SIRPα Binding: Porcine monocytes bind human CD47 via SIRPα, but with lower affinity than human SIRPα, leading to residual phagocytosis .

Future Directions

  • EV-Based Therapies: Preloading pig cells with human CD47 via EVs could enhance xenograft survival without genetic modification .

  • Biomarker Development: Monitoring CD47 expression and SIRPα engagement in real-time during xenotransplantation trials.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests for the format. Please indicate your desired format in the order notes section, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CD47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-303
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
QLIFNITKSVEFTVCNTTVTIPCFVNNMEAKNISELYVKWKFKGKDIFIFDGAQHISKPS EAFPSSKISPSELLHGIASLKMDKRDAVIGNYTCEVTELSREGETIIELKRRFVSWFSPN ENILIVIFPILAILLFWGQFGILTLKYKSSYTKEKTIFLLVAGLMLTIIVIVGAILFIPG EYSTKNACGLGLIVIPTAILILLQYCVFMMALGMSSFTIAILILQVLGHVLSVVGLSLCV SECTPVHGPLLISGLGIIALAELLGLVYMKCVASDHKTIQPPRNN
Uniprot No.

Target Background

Function
CD47, also known as the receptor for SIRPA, plays a crucial role in immune regulation and cell signaling. It prevents the maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells upon binding to SIRPA. Interaction with SIRPG facilitates cell-cell adhesion, enhances T-cell proliferation stimulated by superantigens, and costimulates T-cell activation. CD47 is also involved in memory formation and synaptic plasticity within the hippocampus. It may contribute to membrane transport and/or integrin-dependent signal transduction. CD47 could potentially prevent premature red blood cell elimination. It may be involved in membrane permeability changes induced by viral infections and play a role in memory formation. Additionally, CD47 participates in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets and in the modulation of integrins.
Gene References Into Functions
  1. Amyloid-beta inhibits No-cGMP signaling in a CD36- and CD47-dependent manner. PMID: 21203512
  2. Genetic induction of human CD47 on porcine cells could provide inhibitory signaling to SIRPalpha on human macrophages, offering a novel approach to preventing macrophage-mediated xenograft rejection. PMID: 17360380
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, detected in kidney, liver, platelets, thymus, spleen, macrophages, bone marrow and peripheral blood mononuclear cells.

Q&A

What is the basic molecular structure of pig CD47?

Pig CD47 (also known as integrin-associated protein or IAP) consists of a single extracellular immunoglobulin variable (IgV)-like domain (122 amino acids), followed by five membrane-spanning domains (147 amino acids), and a cytoplasmic tail (16 amino acids). The protein also contains an 18 amino acid putative signal peptide. This structural organization is consistent with CD47 being a member of the immunoglobulin superfamily. The amino acid sequence shows approximately 73% homology to human CD47, confirming its identity as the porcine homolog .

How are pig CD47 isoforms identified and what tissue distribution patterns do they exhibit?

Pig CD47 isoforms can be identified using RT-PCR with primers that bracket the alternatively spliced cytoplasmic tail region. Using this approach, researchers can distinguish three different isoforms based on PCR product size. The major band observed is approximately 800 bp, corresponding to form 2 of human CD47, and is detected in all tested tissues. Forms 1 and 3 (corresponding to human and mouse CD47 variants) are detected in kidney, platelets, thymus, and peripheral blood mononuclear cells (PBMC), while liver and bone marrow express predominantly form 2. The tissue-specific expression pattern suggests potential functional specialization of these isoforms .

What methodologies can be used to clone and express recombinant pig CD47?

The methodology for cloning and expressing recombinant pig CD47 involves:

  • PCR amplification of pig CD47 from cDNA, using primers designed with appropriate restriction sites (e.g., BamHI and EcoRV) for directional cloning

  • Cloning into a eukaryotic expression vector (such as pDR2ΔEF1α) containing:

    • Hygromycin resistance gene for selection

    • Strong promoter (e.g., EF1α) for high expression

  • Transformation into competent bacteria (e.g., DH5α) for plasmid propagation

  • Verification of insert orientation and sequence fidelity

  • Transfection into mammalian cells (e.g., CHO cells) using lipofectamine

  • Selection of stable transfectants using hygromycin B (400 μg/ml)

  • Confirmation of expression by flow cytometry and Western blotting

This approach enables stable expression of functional pig CD47 for experimental studies .

How does pig CD47 interact with thrombospondin (TSP) and what methods are used to study this interaction?

Pig CD47 serves as an adhesion receptor for thrombospondin (TSP), a matrix glycoprotein. This interaction can be studied using cell adhesion assays with the following methodology:

  • Coat surfaces with increasing concentrations of TSP (typically 0-10 μg/ml)

  • Apply CD47-expressing cells (e.g., pig platelets or CD47-transfected CHO cells)

  • Quantify adhesion by measuring alkaline phosphatase (AP-ase) activity colorimetrically

  • Compare adhesion between CD47-expressing cells and control cells

  • Use blocking antibodies (e.g., BRIC126) to confirm CD47-specific adhesion

Research shows that both pig platelets (expressing endogenous CD47) and CD47-transfected CHO cells adhere to TSP-coated surfaces in a concentration-dependent manner, with minimal adhesion occurring below 4 μg/ml TSP. Control CHO cells (vector-only transfected) show negligible adhesion regardless of TSP concentration, confirming the specificity of the CD47-TSP interaction .

What are the differences in CD47 expression levels across various pig cell types?

Flow cytometry analysis using cross-reactive anti-CD47 antibodies (such as BRIC126) reveals differential expression of CD47 across pig blood cell populations:

Cell TypeRelative CD47 ExpressionPattern
PlateletsHighestStrong, uniform
ErythrocytesHighStrong, uniform
GranulocytesHighStrong, uniform
PBMCVariableBroad distribution

The highest expression levels are found on platelets, while peripheral blood mononuclear cells (PBMC) show a broader staining distribution, likely reflecting varied expression levels across different leukocyte populations. This differential expression pattern suggests cell type-specific regulation of CD47 expression that may correlate with functional requirements .

How does pig CD47 interact with fibrinogen and what research methods can elucidate this mechanism?

Pig CD47 mediates adhesion to pig fibrinogen through mechanisms that can be investigated using similar adhesion assays as described for TSP. The methodological approach includes:

  • Coating surfaces with purified pig plasma fibrinogen

  • Applying CD47-expressing cells (platelets or transfected cells)

  • Quantifying adhesion through colorimetric assays

  • Using CD47-specific blocking antibodies to confirm specificity

Experimental data shows that preincubation with the anti-CD47 antibody BRIC126 efficiently blocks the adhesion of pig CD47-expressing cells to fibrinogen-coated surfaces, while isotype-matched control antibodies have no effect. This confirms that pig CD47 functions as an adhesion receptor for fibrinogen, suggesting its role in platelet aggregation and hemostasis .

Why is human CD47 expression in pig cells important for xenotransplantation research?

Human CD47 (hCD47) expression in porcine cells is critical for xenotransplantation due to the species incompatibility between human signal regulatory protein alpha (SIRPα) and pig CD47. This incompatibility leads to enhanced phagocytosis of pig cells by human macrophages, contributing to xenograft rejection. Expressing human CD47 in pig cells provides the following benefits:

  • Reduced phagocytosis by human macrophages

  • Suppressed macrophage-mediated cytotoxicity

  • Decreased inflammatory cytokine production (TNF-α, IL-1β, IL-6)

  • Inhibited human T-cell infiltration

  • Increased xenogeneic hematopoietic engraftment

  • Prolonged survival of porcine skin grafts in non-human primates

These findings demonstrate that human CD47 expression can help overcome one of the key immunological barriers in xenotransplantation by engaging the "don't eat me" signal with human SIRPα receptors .

What methodologies are used to evaluate the effectiveness of human CD47 expression in pig cells for reducing phagocytosis?

The effectiveness of human CD47 expression in pig cells for reducing phagocytosis can be evaluated through several methodological approaches:

  • In vitro phagocytosis assays:

    • Co-culture of fluorescently labeled pig cells (with or without hCD47) with human macrophages

    • Quantification of phagocytosis by flow cytometry or microscopy

    • Measurement of phagocytic index (number of cells ingested per macrophage)

  • Cytokine production assays:

    • Analysis of inflammatory cytokine (TNF-α, IL-1β, IL-6) production by ELISA or intracellular staining

    • Comparison between reactions to wild-type and hCD47-expressing pig cells

  • T-cell infiltration assays:

    • Measurement of T-cell migration toward pig cells using transwell systems

    • Comparison between wild-type and hCD47-expressing pig cells

  • In vivo engraftment models:

    • Transplantation of hCD47-expressing pig cells into humanized mice or non-human primates

    • Monitoring graft survival and function

    • Analysis of immune cell infiltration and activation

These methods allow researchers to comprehensively assess the impact of human CD47 expression on various aspects of xenograft rejection .

What are the limitations of human CD47 expression in preventing xenograft rejection?

Despite its benefits, human CD47 expression in pig cells has several limitations in preventing xenograft rejection:

  • It does not completely prevent phagocytosis by primate macrophages, suggesting additional activation pathways that need to be addressed

  • The CD47-SIRPα interaction represents only one of multiple xenorecognition mechanisms

  • Other immune components, including natural antibodies, complement, and T cells, can still recognize and attack xenografts

  • Overexpression of CD47 may potentially trigger harmful signaling in the pig cells themselves

  • The optimal expression level for functional inhibition without detrimental effects is not well-established

These limitations indicate that while human CD47 expression is beneficial, it needs to be combined with other genetic modifications to achieve long-term xenograft survival. Research continues to focus on developing multi-gene transgenic approaches that address multiple rejection pathways simultaneously .

What is CD47 cross-dressing and how does it differ from transgenic CD47 expression?

CD47 cross-dressing refers to the transfer of CD47 proteins from one cell to another via extracellular vesicles (EVs), including exosomes. This phenomenon differs from transgenic CD47 expression in several key aspects:

  • Source: Cross-dressed CD47 is acquired from external sources (other cells' EVs), while transgenic CD47 is produced by the cell itself

  • Integration: Cross-dressed CD47 is incorporated into the plasma membrane from the outside, while transgenic CD47 is expressed from within the cell

  • Signaling: Most critically, cross-dressed CD47 can provide the anti-phagocytic "don't eat me" signal by interacting with SIRPα but does not transmit potentially harmful signals to the recipient cell

  • Duration: Cross-dressed CD47 may have a more transient presence on the cell surface compared to stably expressed transgenic CD47

Research demonstrates that both normal and tumor cells overexpressing CD47 can release EVs capable of efficiently transferring CD47 to other cells, providing an alternative mechanism for CD47-mediated protection against phagocytosis without the potential drawbacks of direct overexpression .

What methodologies are used to detect and quantify CD47 cross-dressing on cell surfaces?

CD47 cross-dressing can be detected and quantified using several methodological approaches:

  • Flow cytometry:

    • Direct staining with species-specific anti-CD47 antibodies

    • For human CD47 detection on pig cells: BV786- or AF647-conjugated anti-human specific CD47 mAb B6H12

    • For detection of both human and pig CD47: PE-conjugated anti-human CD47 mAb CC2C6 (cross-reactive with pig CD47)

    • Expression is quantified as median fluorescence intensity

  • Confocal microscopy:

    • Visualization of fluorescently labeled CD47 transferred to recipient cells

    • Co-localization studies with membrane markers

  • Functional assays:

    • SIRPα binding assays using recombinant human SIRPα/CD172a Fc chimera protein

    • Phagocytosis inhibition assays comparing cells before and after CD47 cross-dressing

  • Extracellular vesicle tracking:

    • Labeling EVs with membrane dyes (e.g., PKH26, PKH67)

    • Tracking the transfer of labeled EVs to recipient cells

These methods allow researchers to distinguish between autogenous (cell-expressed) and cross-dressed (acquired) CD47 on cell surfaces .

How can the harmful effects of CD47 overexpression be minimized while maintaining its anti-phagocytic function?

Minimizing the harmful effects of CD47 overexpression while maintaining its anti-phagocytic function can be approached through several strategies:

Research indicates that CD47 cross-dressing might be particularly promising as it provides the beneficial "don't eat me" signal without inducing cell death or dysfunction that can occur when CD47 is directly overexpressed and ligated in the cells .

What are the key considerations for designing a stable pig CD47 expression system?

When designing a stable pig CD47 expression system, researchers should consider:

  • Vector selection:

    • Choose vectors with strong promoters (e.g., EF1α) for high expression

    • Include appropriate selection markers (e.g., hygromycin resistance)

    • Consider vectors with SV40 replication origin for high copy number in certain cells

  • Cloning strategy:

    • Design primers with appropriate restriction sites for directional cloning

    • Ensure the full-length open reading frame (ORF) is included

    • Use high-fidelity polymerases (e.g., platinum pfx-DNA polymerase) to minimize errors

  • Host cell selection:

    • CHO cells are commonly used and well-characterized

    • Consider cells relevant to the specific research question (e.g., endothelial cells for vascular studies)

  • Transfection optimization:

    • Optimize cell density (e.g., 50% confluence for CHO cells)

    • Determine optimal DNA amount (e.g., 8 μg for 25-cm² flask)

    • Select appropriate transfection reagent (e.g., Lipofectamine)

  • Selection protocol:

    • Establish appropriate antibiotic concentration (e.g., 400 μg/ml hygromycin B)

    • Allow sufficient selection time (≈2 weeks)

    • Include non-transfected control cells to confirm selection efficacy

  • Expression verification:

    • Use flow cytometry with appropriate antibodies

    • Confirm expression by Western blotting

    • Verify functionality through binding or adhesion assays

Following this methodological framework enables successful establishment of stable pig CD47 expression systems for functional and translational studies .

How can researchers troubleshoot inconsistent results in CD47-SIRPα binding assays?

When troubleshooting inconsistent results in CD47-SIRPα binding assays, researchers should systematically address:

  • Reagent quality:

    • Verify the integrity of recombinant SIRPα proteins by SDS-PAGE

    • Confirm antibody specificity and activity

    • Check for protein degradation in stored samples

  • Species compatibility:

    • Ensure appropriate species matching (human SIRPα with human CD47, pig SIRPα with pig CD47)

    • For cross-species interactions, validate binding capacity in control experiments

  • Expression levels:

    • Quantify CD47 expression by flow cytometry

    • Normalize binding data to expression levels

    • Consider cell-to-cell variability in expression

  • Technical considerations:

    • Standardize cell numbers and protein concentrations

    • Control incubation times and temperatures

    • Minimize batch effects by processing samples simultaneously

  • Controls:

    • Include isotype-matched control antibodies (e.g., INIA3B10)

    • Use cells lacking CD47 as negative controls

    • Include known positive interactions as reference

  • Detection methods:

    • If using flow cytometry, optimize fluorochrome selection to avoid spectral overlap

    • For microscopy-based assays, standardize image acquisition parameters

    • In binding ELISAs, optimize blocking conditions to reduce background

By systematically addressing these factors, researchers can enhance the reproducibility and reliability of CD47-SIRPα binding assays .

What experimental approaches can resolve contradictory findings about CD47 function in different experimental systems?

To resolve contradictory findings about CD47 function across different experimental systems, researchers can implement the following approaches:

  • Comprehensive system characterization:

    • Fully characterize each experimental system (cell types, species origin, CD47 variants expressed)

    • Document expression levels quantitatively across systems

    • Verify the presence of relevant co-receptors and signaling molecules

  • Direct comparative studies:

    • Test multiple systems in parallel under identical conditions

    • Use standardized reagents, protocols, and analysis methods

    • Implement blinded analysis to minimize bias

  • Genetic manipulation strategies:

    • Use CRISPR/Cas9 to create isogenic cell lines differing only in CD47

    • Perform rescue experiments by reintroducing CD47 into knockout cells

    • Create domain-swap chimeras to identify critical functional regions

  • Multi-parameter analysis:

    • Assess multiple functional outcomes simultaneously (e.g., phagocytosis, adhesion, signaling)

    • Use multi-omics approaches to capture system-wide effects

    • Implement time-course studies to capture dynamic processes

  • In vitro to in vivo translation:

    • Validate key findings in physiologically relevant in vivo models

    • Compare results across multiple animal models

    • Correlate in vitro mechanisms with in vivo outcomes

  • Molecular mechanism dissection:

    • Investigate underlying signaling pathways in each system

    • Examine post-translational modifications of CD47

    • Consider the contribution of alternative splicing variants

This systematic approach can help identify the specific conditions or contexts that explain seemingly contradictory findings about CD47 function in different experimental systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.