Recombinant Pig Melanocortin receptor 4 (MC4R)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Pig MC4R

Key Domains:

  • Extracellular N-terminus: Critical for ligand binding and receptor activation .

  • Intracellular loops: Facilitate G protein coupling (Gs subtype) .

Functional Roles in Physiology

Recombinant pig MC4R retains the biological functions of native MC4R:

  • Energy Homeostasis: Regulates feeding behavior and energy expenditure via hypothalamic signaling .

  • Growth Traits: Polymorphisms in porcine MC4R correlate with fat deposition, growth rate, and feed efficiency .

  • Reproductive Modulation: Influences LH and prolactin secretion in ovarian studies .

Research Applications

Recombinant pig MC4R is implicated in:

PathwayRelated Proteins
Neuroactive ligand-receptor interactionSSTR4, ADRB2B, GRM6, APLNR, PTH1R

Key Research Findings

  • Agonist Studies: Recombinant MC4R activation by α-MSH increases cAMP production (EC₅₀ = 0.8 nM), while AgRP suppresses basal activity, highlighting its inverse agonism .

  • Ciliary Dynamics: MC4R undergoes constitutive ubiquitination and exits neuronal cilia unless inhibited by AgRP, a mechanism critical for appetite regulation .

  • MRAP2 Dependency: Ciliary localization of MC4R requires Melanocortin Receptor Accessory Protein 2 (MRAP2) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery information, please contact your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC4R; Melanocortin receptor 4; MC4-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MNSTHHHGMHTSLHFWNRSTYGLHSNASEPLGKGYSEGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAVCTVS GVLFIIYSDSSAVIICLITVFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL IYALRSQELRKTFKEIICCYPLGGLCDLSSRY
Uniprot No.

Target Background

Function
Melanocortin receptor 4 (MC4R) is a receptor specific for the heptapeptide core common to adrenocorticotropic hormone (ACTH) and α-, β-, and γ-melanocyte-stimulating hormone (MSH). It plays a pivotal role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).
Gene References Into Functions
  1. This research indicates that genetic selection against boar taint is feasible using MC4R as a marker. PMID: 26020871
  2. The findings suggest that LEPR, MC4R, PIK3C3, and VRTN are valuable markers for accurately predicting breeding values in Duroc pigs. PMID: 24128088
  3. Transcriptional profiling was employed to identify genes and pathways responsive to intracerebroventricular injection of the MC4R agonist [Nle(4), d-Phe(7)]-α-melanocyte-stimulating hormone in pigs homozygous for the missense mutation in the MC4R. PMID: 20215418
  4. This study did not find any significant associations for polymorphisms in insulin-like growth factor 2, GTP Binding Protein alpha Subunits, Gs, and melanocortin receptor 4 genes with reproductive traits of Polish Landrace and Large White pigs. PMID: 23199214
  5. Linkage disequilibrium analysis among MC4R, LEP, and H-FABP revealed that these genes were independent. PMID: 22290286
  6. The c.1426G>A polymorphism affects daily gain, feed conversion ratio, and ham weight in both breeds, lean cuts in the Italian Duroc, and backfat thickness in the Italian Large White. PMID: 22197097
  7. MC4R allelic variants had no demonstrable effects on meat quality traits. PMID: 21196086
  8. The effects of missense mutations of MC4R on carcass composition, growth traits, and meat quality in 1191 gilts of five swine breeds are reported. PMID: 20374902
  9. No effect of the MC4R trait nucleotides could be observed on muscle growth. PMID: 19674865
  10. Results of associated analysis show that the polymorphism of the MC4R gene was associated with traits of back fat thickness (BF). PMID: 16520310
  11. A polymorphism within the MC4R gene is associated with feed intake and increased growth. PMID: 16734684
  12. A polymorphism within the MC4R gene is associated with the fat/meat ratio. PMID: 16879346
  13. Characterization of polymorphisms in the MC4R gene in relation to growth and fat deposition. PMID: 16879362
  14. pMC4R mutants D298N and R236H do not exhibit any overt functional defects. PMID: 18262384
  15. MC4R genes were sequenced in 72 pigs belonging to lean (Large White and Duroc), fat (Meishan and Casertana) breeds, and also Wild Boar. PMID: 18363978

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MC4R gene and why is it significant in pig research?

The Melanocortin-4 Receptor (MC4R) is a G-protein coupled receptor implicated in mediating the effect of leptin on food intake and energy balance . In pigs, MC4R plays a crucial role in regulating growth, meat productivity traits, and feed intake . The gene is particularly significant in pig research because polymorphisms in MC4R have been directly associated with economically important traits including growth rate, fat deposition, and feed efficiency . Specifically, MC4R was chosen for study because it is known to be involved in obesity and energy balance control in humans and rodent models, with translational value for understanding the molecular basis of these traits in livestock production .

What is the molecular structure of pig MC4R?

Pig MC4R belongs to the family A of G-protein coupled receptors (GPCRs) with seven transmembrane domains (TMs) connected by alternating extracellular loops (ELs) and intracellular loops. The N-terminus is extracellular, and the C-terminus is intracellular . The receptor has some unique structural features compared to other family A GPCRs:

  • Absence of the conserved disulfide bond linking TM3 and EL2

  • Presence of an intraloop disulfide bond in EL3

  • Short intracellular and extracellular loops, particularly EL2

  • Substitution of the highly conserved Pro in TM5 and Asn in TM7 (in the NPxxY motif) with Met and Asp, respectively

The pig MC4R gene is intronless, with an open reading frame encoding a protein of 332 amino acids, similar to the human MC4R .

How is MC4R tissue distribution characterized in pigs?

In pigs, as in other mammals, MC4R is primarily expressed in the central nervous system. The receptor mRNA is widely distributed throughout the brain, with particularly high expression in:

  • Hypothalamus, especially in the paraventricular nucleus (PVN), including both parvicellular and magnocellular neurons

  • Cortex

  • Thalamus

  • Brainstem

  • Spinal cord

Recent studies have also confirmed MC4R expression in astrocytes in addition to neurons . This neural distribution pattern aligns with MC4R's role in energy homeostasis regulation, as these brain regions are critical control centers for appetite and metabolism.

What are the major polymorphisms identified in pig MC4R and their functional significance?

A pivotal polymorphism in pig MC4R is the Asp298Asn missense mutation, which has been significantly associated with growth and food intake traits . This mutation occurs within the highly conserved NPLIY motif found in G protein-coupled receptors. The functional significance of this polymorphism has been experimentally demonstrated:

ParameterAsp298 VariantAsn298 Variant
Ligand binding (NDP-αMSH)NormalNormal
cAMP productionStimulates cAMP accumulationUnable to stimulate cAMP production
Signaling capacityFunctionalImpaired
Association with growth traitsSlower growthFaster growth
Effect on feed intakeLowerHigher

The inability of the Asn298 variant to stimulate cAMP production in response to ligand binding suggests that Asp298 is required for normal MC4R signaling to adenylyl cyclase . Importantly, this functional impairment may explain the observed associations with growth and feed intake phenotypes.

How do MC4R allele frequencies vary across different pig breeds and populations?

Studies examining MC4R polymorphisms in various pig breeds have revealed significant differences in allele frequencies. For example, in breeding populations in Russia, the MC4R/Taq I genotypes show the following distribution:

Breed/CrossG Allele FrequencyA Allele Frequency
Danish Landrace, Canadian Landrace, and crossbred pigs0.710.29

This higher frequency of the G allele (0.71) compared to the A allele (0.29) across all test groups suggests potential selection pressure on this locus .

The distribution of favorable alleles varies by breed and might reflect different selection objectives in breeding programs. The heterozygous genotype AG showed favorable effects in Danish Landrace (LD) breed, with significant effects on days to 100 kg and average daily gain, while the homozygous GG genotype was favorable in crossbred Danish Landrace × Canadian Landrace (LD × LC) .

What approaches are recommended for genotyping MC4R polymorphisms in pig populations?

For researchers studying MC4R polymorphisms in pigs, the PCR-RFLP (Polymerase Chain Reaction-Restriction Fragment Length Polymorphism) method has been effectively utilized to identify genetic variants . The methodology involves:

  • DNA extraction from blood, tissue, or hair follicle samples

  • PCR amplification of the MC4R gene region containing the polymorphism of interest

  • Restriction enzyme digestion (e.g., with Taq I for the Asp298Asn polymorphism)

  • Gel electrophoresis to visualize restriction patterns that identify different alleles

For more comprehensive genetic analysis, direct sequencing of the PCR product is recommended, particularly when searching for novel polymorphisms. This approach successfully identified the +179A/G SNP in the 5′-UTR of CCKAR gene using a similar strategy , suggesting its applicability for MC4R research as well.

What expression systems are optimal for producing recombinant pig MC4R protein?

For functional studies of recombinant pig MC4R, mammalian expression systems have proven most effective. Based on the literature:

  • Human embryonic kidney (HEK) 293 cells have been successfully used for expression and functional analysis of pig MC4R variants . This system provides appropriate post-translational modifications and cellular machinery for receptor trafficking and signaling.

  • The experimental protocol typically involves:

    • Cloning the pig MC4R coding sequence into a mammalian expression vector

    • Transfection of HEK293 cells using methods like calcium phosphate precipitation or lipofection

    • Selection of stable transfectants if long-term studies are required

    • Verification of expression through immunoblotting, immunocytochemistry, or functional assays

This expression system has successfully demonstrated functional differences between MC4R variants, such as the impaired signaling of the Asn298 variant compared to the Asp298 variant .

What are the technical challenges in producing functional recombinant MC4R?

Producing functional recombinant MC4R presents several technical challenges researchers should anticipate:

  • Post-translational modifications: MC4R contains potential N-linked glycosylation sites (at the N terminus: Asn3, Asn17, and Asn26; and at EL1: Asn108) . While it is known that MC4R is glycosylated, the exact sites and functional significance remain undetermined, making proper glycosylation a potential challenge.

  • Protein trafficking: Ensuring proper trafficking of the receptor to the plasma membrane can be difficult. The C-terminus contains two conserved Cys residues (Cys318 and Cys319) that might serve as palmitoylation sites anchoring the C-terminus to the plasma membrane . Mutation studies targeting these residues may help understand their role in trafficking.

  • Maintaining receptor stability: The MC4R has short extracellular loops, particularly EL2, and lacks the highly conserved disulfide bond linking TM3 and EL2 that stabilizes many GPCRs . This may affect receptor stability in heterologous expression systems.

  • Ligand binding assays: For accurate assessment of receptor function, proper ligand binding assays are essential. NDP-αMSH has been successfully used for binding studies with recombinant pig MC4R .

How can researchers validate the functionality of recombinant pig MC4R?

To validate the functionality of recombinant pig MC4R, researchers should employ a multi-faceted approach:

  • Ligand binding assays: Using labeled ligands such as NDP-αMSH to assess receptor binding capacity . This confirms that the recombinant protein maintains its ability to recognize and bind appropriate ligands.

  • Signal transduction assays: Measuring cAMP accumulation in response to agonist stimulation is critical, as MC4R primarily signals through the Gs/adenylyl cyclase pathway . The comparison between wild-type and mutant receptors (e.g., Asp298 vs. Asn298) should reveal differences in signaling capacity.

  • Trafficking and localization studies: Using fluorescently tagged receptors or immunocytochemistry to verify proper membrane localization.

  • Dose-response curves: Establishing dose-response relationships for various ligands provides valuable information about receptor sensitivity and efficacy.

  • Antagonist studies: Testing the ability of known MC4R antagonists to block agonist responses confirms receptor specificity.

How does porcine MC4R signaling differ from other species?

While the fundamental signaling pathway of MC4R is conserved across species, several species-specific differences in porcine MC4R have been documented:

  • Polymorphism effects: The Asp298Asn polymorphism in pigs has clear functional consequences, affecting cAMP signaling without altering ligand binding . This specific polymorphism and its effects appear to be unique to pigs.

  • Physiological outcomes: In pigs, MC4R signaling strongly influences growth rate, feed intake, and fat deposition with significant economic implications for animal production . While MC4R regulates energy balance in all mammals, the specific growth traits affected may vary between species.

  • Evolutionary adaptations: Sequencing of the MC4R gene across seven diverse genera within Suiformes (including Hippopotamidae and Tayassuidae) suggests evolutionary adaptations specific to different pig-related lineages . These adaptations may reflect different selective pressures on feeding behavior and energy metabolism.

What is known about MC4R interaction with other regulatory pathways in pigs?

MC4R interacts with several other regulatory pathways in pigs that collectively modulate energy homeostasis:

  • Leptin pathway: MC4R mediates the effects of leptin on food intake and energy balance . Leptin, produced by adipose tissue, signals through POMC neurons to increase α-MSH production, which activates MC4R.

  • Cholecystokinin (CCK) interaction: Studies in MC4R knockout mice have shown reduced sensitivity to CCK, a gut hormone that inhibits food intake . This suggests a potential interaction between MC4R and CCK signaling systems. Similarly, the porcine cholecystokinin type A receptor (CCKAR) gene has been identified as another candidate gene for performance traits due to its role in feed intake regulation .

  • Insulin signaling: MC4R deficiency is associated with hyperinsulinemia in mouse models . In pigs, this interaction may influence both growth and metabolic traits.

  • YY1 transcription factor binding: A SNP in the 5′-UTR of CCKAR (+179A/G) disrupts the binding of the YY1 transcription factor, which regulates gene expression . Similar regulatory mechanisms might apply to MC4R expression, though specific studies in porcine MC4R are needed.

What phenotypic effects have been observed with MC4R variants in pigs?

The phenotypic effects of MC4R variants in pigs have been extensively documented across multiple breeds and populations:

TraitEffect of MC4R VariantsReference
Days to 100 kgAG genotype: -1.43 (LD male), -2.81 (LD female) days
Average Daily Gain (ADG)AG genotype: +61.17 (LD male), +26.3 (LD female) g/day
GG genotype in crossbred: +74.2 g/day
Backfat Thickness (BFT)GG genotype in crossbred: -1.5 mm
Daily Feed Intake (DFI)Significantly greater in +471G homozygotes of CCKAR gene (potentially interacting with MC4R pathway)

These findings demonstrate that the MC4R genotype significantly influences growth efficiency, with heterozygotes (AG) showing favorable effects in Danish Landrace and homozygotes (GG) showing favorable effects in crossbred animals . The consistent association of MC4R variants with multiple performance traits across different genetic backgrounds confirms its central role in regulating growth and metabolism in pigs.

How do findings from pig MC4R research inform human obesity studies?

Research on pig MC4R provides valuable insights for human obesity studies due to several key parallels:

  • Genetic mechanism: MC4R deficiency in humans causes a similar phenotype to that observed in pigs with certain MC4R variants. In humans with MC4R deficiency, individuals experience constant hunger, never feel satisfied after meals, and tend to gain weight easily . This mirrors observations in pigs with variants that affect MC4R signaling.

  • Prevalence and penetrance: In humans with severe childhood-onset obesity, approximately 1 in 20 individuals carries a faulty MC4R gene, while in the general population, the frequency is about 1 in 500 . This gene dosage effect is also observed in pig populations, where heterozygotes display intermediate phenotypes .

  • Physiological differences: People with MC4R deficiency have more muscle, bigger bones, lower blood pressure, and lower cholesterol than individuals of the same weight without MC4R deficiency . These distinctive metabolic characteristics provide a model for understanding the complex relationship between MC4R signaling and peripheral metabolism.

  • Treatment responses: Recent findings that GLP-1 agonists like semaglutide and tirzepatide are effective in people with faulty MC4R genes may inform targeted therapies for both species. Similar pharmacological approaches might be explored in pigs.

What methodological approaches from mouse MC4R studies can be applied to pig research?

Mouse models have contributed significantly to our understanding of MC4R biology. Several methodological approaches from mouse studies can be effectively adapted for pig research:

  • Knockout models: The MC4R knockout mouse model provided definitive evidence for MC4R's role in energy homeostasis, demonstrating maturity-onset obesity, hyperphagia, increased linear growth, hyperinsulinemia, and hyperglycemia . Similar gene editing approaches using CRISPR/Cas9 could generate pig MC4R knockout models to study species-specific effects.

  • Tissue-specific expression analysis: Studies in mice using green fluorescent protein under the control of the MC4R promoter have precisely mapped MC4R expression patterns . This approach could be adapted to characterize the distribution of MC4R in pig tissues.

  • Behavioral assays: In mice, MC4R knockouts show delayed meal termination and reduced sensitivity to cholecystokinin . Similar sophisticated feeding behavior analyses could reveal nuanced effects of MC4R variants in pigs.

  • Diet challenge studies: MC4R knockout mice show exacerbated obesity when fed a high-fat diet, with impaired diet-induced thermogenesis and reduced physical activity . Analogous dietary challenge studies in pigs with different MC4R genotypes could reveal similar gene-diet interactions.

What are the most promising directions for future pig MC4R research?

Based on current knowledge gaps and emerging technologies, several research directions appear particularly promising:

  • Fine-mapping regulatory elements: While the coding region polymorphisms of pig MC4R have been well-studied, less is known about regulatory regions. Investigating promoter and enhancer elements that control MC4R expression could reveal additional sources of phenotypic variation, similar to the discovery of the YY1 transcription factor binding site in the 5′-UTR of CCKAR .

  • Epigenetic regulation: Studies exploring how environmental factors might influence MC4R expression through epigenetic modifications could bridge the gap between genotype and phenotype.

  • Receptor trafficking and turnover: Detailed studies of how MC4R variants affect receptor trafficking, internalization, and recycling could provide mechanistic insights into the observed functional differences.

  • Pathway integration: Comprehensive analysis of how MC4R signaling integrates with other metabolic pathways in pigs, particularly CCKAR signaling which also influences feed intake and growth .

  • Therapeutic targeting: Development of MC4R-specific compounds that could modulate receptor activity in a controlled manner, potentially allowing precise regulation of growth and feed efficiency in production settings.

  • Systems biology approaches: Integration of genomic, transcriptomic, proteomic, and metabolomic data to build comprehensive models of how MC4R variants influence whole-body physiology in pigs.

How can researchers accurately measure MC4R-mediated signaling responses?

Accurate measurement of MC4R-mediated signaling requires careful attention to assay conditions and appropriate controls:

  • cAMP accumulation assays: Since MC4R primarily signals through Gs to stimulate adenylyl cyclase, cAMP measurement is the gold standard for functional analysis . Researchers should:

    • Use appropriate time points (typically 15-30 minutes post-stimulation)

    • Include phosphodiesterase inhibitors (e.g., IBMX) to prevent cAMP degradation

    • Employ sensitive detection methods such as TR-FRET or enzyme immunoassays

    • Generate complete dose-response curves with multiple concentrations of agonist

  • Reporter gene assays: Alternatively, cAMP-responsive reporter genes (e.g., CRE-luciferase) can provide a convenient readout of receptor activation. These systems allow high-throughput screening but should be validated against direct cAMP measurements.

  • Calcium mobilization: Although not the primary signaling pathway, MC4R can sometimes couple to calcium mobilization. Fluorescent calcium indicators can provide additional information about receptor signaling diversity.

  • β-arrestin recruitment: BRET or FRET-based assays measuring β-arrestin recruitment can reveal important aspects of receptor desensitization and internalization.

  • Control experiments: Always include positive controls (known MC4R agonists like NDP-αMSH) and negative controls (untransfected cells, inactive receptor mutants) to validate assay performance.

What considerations are important when comparing different MC4R variants in experimental systems?

  • Expression level normalization: Different variants may express at different levels, confounding functional comparisons. Techniques to address this include:

    • Quantitative western blotting using epitope tags or MC4R-specific antibodies

    • Flow cytometry to measure surface expression

    • Binding assays with saturating concentrations of radioligand

    • Creating stable cell lines with similar expression levels

  • Trafficking differences: Some variants may have impaired trafficking to the cell surface. Cell surface biotinylation or immunofluorescence microscopy can distinguish between total expression and functional surface expression.

  • Ligand selection: Different ligands may show distinct patterns of bias between variants. Testing multiple ligands (e.g., α-MSH, β-MSH, ACTH, and synthetic agonists) provides a more complete functional profile.

  • Signal transduction pathways: Comprehensive signaling analysis should include measurements of multiple pathways (cAMP, ERK1/2, calcium, β-arrestin) to detect potential signaling bias.

  • Receptor reserve considerations: In systems with high receptor expression, significant receptor reserve may mask partial reductions in efficacy. Reducing receptor expression or using irreversible antagonists to inactivate a fraction of receptors can reveal these differences.

How should researchers interpret conflicting results from different pig MC4R studies?

When faced with conflicting results from different studies on pig MC4R, researchers should systematically evaluate several factors:

  • Breed and genetic background differences: The effects of MC4R variants may differ between breeds due to different genetic backgrounds. For example, the heterozygous AG genotype shows favorable effects in Danish Landrace, while the GG genotype is favorable in crossbred Danish Landrace × Canadian Landrace .

  • Environmental interactions: Housing conditions, diet composition, feeding regimes, and other environmental factors may interact with MC4R genotypes to produce different phenotypic outcomes.

  • Age-dependent effects: The impact of MC4R variants on growth and feed intake may vary with developmental stage. Some effects might be more pronounced during specific growth phases.

  • Methodological differences: Variations in:

    • Genotyping methods and accuracy

    • Phenotype measurement techniques

    • Statistical analysis approaches

    • Sample sizes and statistical power

  • Gene-gene interactions: Interactions with other genes in the energy homeostasis pathway may modulate MC4R effects. For example, potential interactions between MC4R and CCKAR pathways could explain some inconsistencies .

When evaluating conflicting literature, a systematic meta-analysis approach that accounts for these factors can help reconcile apparently discordant findings.

What statistical approaches are most appropriate for associating MC4R variants with phenotypic traits?

For robust association studies linking MC4R variants to pig phenotypic traits, researchers should consider these statistical approaches:

  • Mixed linear models: These account for both fixed effects (e.g., MC4R genotype, sex, season) and random effects (e.g., sire, dam, litter), reducing confounding.

  • Correction for multiple testing: When examining multiple traits, appropriate corrections (Bonferroni, false discovery rate) should be applied to p-values to control type I error rates.

  • Appropriate covariates: Including relevant covariates such as:

    • Age at measurement

    • Initial weight

    • Environmental factors

    • Herd/management effects

  • Sample size considerations: Power analysis should guide sample size determination. The effect of AG genotype showing significant effects of -1.43 (LD male) and -2.81 (LD female) days for Days to 100 kg can serve as a reference effect size.

  • Haplotype analysis: Considering multiple SNPs together in haplotypes rather than individual SNPs may better capture the genetic effects, especially when multiple functional variants exist.

  • Meta-analysis approaches: Combining data across multiple studies increases power and can reveal consistent effects amid study-specific variation.

  • Bayesian approaches: These provide a framework for incorporating prior knowledge and handling uncertainty, especially valuable in complex trait analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.