Recombinant Pig Melatonin receptor type 1A (MTNR1A)

Shipped with Ice Packs
In Stock

Description

General Information

The melatonin receptor 1A (MTNR1A) is a receptor for melatonin, a hormone primarily secreted by the pineal gland . MTNR1A, also known as MT1, is a G protein-coupled receptor (GPCR) . GPCRs like MTNR1A respond to signaling molecules and affect numerous physiological processes .

Structure and Function

MTNR1A is one of two high-affinity forms of the melatonin receptor . It plays a crucial role in regulating circadian rhythms and other physiological functions . Studies of MT1-Gi protein complexes have shown the structural details of ligand binding . The structures of 2-iodomelatonin- and ramelteon-bound MT1-Gi complexes have been determined with resolutions of 3.1 and 3.3 Å, respectively .

Key structural features and functional aspects of MTNR1A include:

  • Ligand Binding: MTNR1A binds ligands like 2-iodomelatonin and ramelteon in its orthosteric pockets . The binding site's configuration is influenced by residues surrounding the iodine group and alkylamide tail of melatonin .

  • Activation Mechanism: The activation of MTNR1A involves conformational changes, including the rotation of residue Y187 and the formation of a hydrogen bond with N162, which reduces the ligand entrance diameter .

  • G Protein Coupling: MTNR1A can couple to different G proteins, including Gi/o and Gq/11 . The intracellular loop 2 (ICL2) region of MTNR1A is thought to play a role in determining G protein coupling specificity .

MTNR1A and Disease

The MTNR1A gene is implicated in several diseases, particularly those related to metabolic function and diabetes .

  • Type 2 Diabetes (T2D): Research indicates that MTNR1A is a novel risk gene for T2D . Specific variants within the MTNR1A gene have been linked to T2D in studies of Italian families .

  • Gestational Diabetes: Variants in the MTNR1A gene are associated with gestational diabetes and polycystic ovary syndrome .

  • Renal Function Decline: The single-nucleotide polymorphism Rs4862705 in the MTNR1A gene is associated with renal function decline in individuals with type 1 diabetes .

MTNR1A Variants and Functional Selectivity

Natural variants in MTNR1A can affect its function, providing insights into the structural elements involved in receptor activation . A study identified 36 nonsynonymous variants in MTNR1A and characterized their signaling profiles . These variants can be grouped based on their signaling profiles, revealing clusters with wild-type-like behavior or selective defects in βarrestin-2 recruitment .

Table 2. MT1 Variant Receptors Bind to Melatonin as well as the MT1-WT Except P80L

Receptors$$K_d$$ (pM) ± SEM
Wild Type101 ± 9.3
V52A99 ± 6.9
R54W178 ± 25
P80LNo binding
S87L136 ± 19
I88V79 ± 4.5
G96D81 ± 8.7
I112N244 ± 75
R125C227 ± 61
H131R62 ± 11
L138P171 ± 61
G166E63 ± 1.2
I212T101 ± 5.0
I257F168 ± 7.2
A266V224 ± 43
S267G186 ± 54
R307S40 ± 2.5
I309T75 ± 5.6
C314R48 ± 7.8
K334N395 ± 68
N342S140 ± 43
V345I69 ± 1.8

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MTNR1A; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA
Uniprot No.

Target Background

Function

High-affinity receptor for melatonin. It likely mediates the reproductive and circadian effects of melatonin. Receptor activity is mediated by pertussis toxin-sensitive G proteins that inhibit adenylate cyclase activity.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of MTNR1A in porcine models?

MTNR1A functions as a high-affinity receptor for melatonin, mediating reproductive and circadian actions in pigs. The activity of this receptor is mediated by pertussis toxin-sensitive G proteins that inhibit adenylate cyclase activity . In porcine models, as in other mammals, MTNR1A likely plays a critical role in regulating reproductive seasonality and circadian rhythms. Research methodologies typically involve receptor binding assays, functional signaling studies, and phenotypic assessments of circadian and reproductive parameters.

How is recombinant pig MTNR1A typically expressed in laboratory settings?

Recombinant pig MTNR1A can be expressed using various expression systems similar to those used for other mammalian MTNR1A proteins. Common methodological approaches include:

  • Bacterial expression systems (E. coli)

  • Yeast expression systems (Pichia pastoris)

  • Insect cell expression systems (baculovirus)

  • Mammalian cell expression systems (HEK293, CHO cells)

For optimal functional studies, mammalian expression systems are often preferred as they provide appropriate post-translational modifications and membrane trafficking for this G-protein coupled receptor. The expression constructs typically include affinity tags (His, FLAG, etc.) to facilitate purification and detection .

What are the primary sequence similarities between pig MTNR1A and other species?

Pig MTNR1A shares significant sequence homology with other mammalian species. While the specific search results don't provide the exact sequence identity percentages for pig MTNR1A, the protein belongs to the G-protein coupled receptor 1 family . Other mammalian MTNR1A proteins typically show 85-95% sequence identity in conserved transmembrane domains and functional regions. Methodology for comparison includes multiple sequence alignment tools such as CLUSTAL W, MUSCLE, or T-Coffee, followed by phylogenetic analysis.

How should experimental designs account for circadian variation when studying recombinant pig MTNR1A?

When designing experiments involving recombinant pig MTNR1A, researchers must account for circadian variation in the following ways:

  • Sampling Protocol: Establish a consistent time-of-day sampling protocol to minimize variation from endogenous circadian rhythms

  • Light Conditions: Document and control light exposure conditions precisely

  • Internal Controls: Include appropriate time-matched controls

  • Expression Analysis: Conduct time-course experiments that span at least 24 hours

Research has shown that MTNR1A expression and function may vary throughout the day, with potential impact on experimental outcomes. The receptor is implicated in melatonin signaling to the suprachiasmatic nucleus (SCN), which can stabilize circadian rhythm against light-induced phase shifts .

What methodological approaches are most effective for studying MTNR1A-mediated signaling pathways in porcine cells?

For studying MTNR1A-mediated signaling in porcine cells, the following methodological approaches are recommended:

Table 1: Methodologies for MTNR1A Signaling Analysis

ApproachApplicationAdvantagesLimitations
cAMP assaysMeasuring inhibition of adenylate cyclaseDirect measurement of primary signaling eventMay miss secondary signaling events
Calcium mobilizationMeasuring Gαq pathway activationReal-time kinetic readoutLess sensitive for Gαi-coupled receptors
GTPγS bindingMeasuring G protein activationDirectly measures receptor-G protein couplingTechnically challenging
BRET/FRETMeasuring protein-protein interactionsAllows real-time monitoring in live cellsRequires protein modification
RNA interferenceKnockdown studiesAllows specific targeting of receptorMay have off-target effects

For comprehensive analysis, researchers should employ multiple complementary approaches to validate findings and characterize signaling cascade components.

How do genetic polymorphisms in pig MTNR1A affect receptor function and experimental reproducibility?

Genetic polymorphisms in MTNR1A can significantly impact receptor function and experimental results. Research on human MTNR1A has identified variants like rs12506228 that are associated with altered receptor expression . For porcine studies, researchers should:

  • Sequence Verification: Always verify the sequence of the recombinant construct

  • Breed Documentation: Document the pig breed source of the MTNR1A

  • SNP Analysis: Characterize relevant single nucleotide polymorphisms

  • Expression Correlation: Analyze correlations between genetic variants and expression levels

Studies have shown that genetic variations near the MTNR1A gene can affect expression levels, which may lead to altered melatonin signaling through type 1A receptors . This has functional consequences - for example, reduced MTNR1A expression could increase sensitivity to nocturnal light and disrupt circadian regulation.

What are the technical challenges in producing functional recombinant pig MTNR1A and how can they be overcome?

Production of functional recombinant pig MTNR1A presents several technical challenges:

  • Proper folding: As a 7-transmembrane protein, MTNR1A requires appropriate membrane insertion and folding

    • Solution: Use mammalian expression systems with proper chaperones

  • Post-translational modifications: Ensure glycosylation and other modifications

    • Solution: Verify modification sites and select expression systems accordingly

  • Functional verification: Confirm receptor binds melatonin with high affinity

    • Solution: Implement radioligand binding assays or functional signaling assays

  • Stability issues: Membrane proteins often have stability problems

    • Solution: Consider fusion partners, stability tags, or optimized detergents

When designing experimental controls, it's essential to include both positive controls (known functional MTNR1A) and negative controls (mock transfections) to ensure reliable interpretation of results .

How should researchers interpret functional differences between recombinant pig MTNR1A and endogenous receptor?

When comparing recombinant and endogenous MTNR1A function, researchers should consider several factors:

  • Expression level differences: Recombinant systems often produce higher protein levels than endogenous expression

    • Methodology: Quantitative Western blot or flow cytometry for precise quantification

  • Cellular context: Absence of natural interaction partners in heterologous systems

    • Approach: Co-express known interaction partners or use native cell backgrounds

  • Signaling pathway variations: Different cell types may have varying levels of signaling components

    • Solution: Characterize the expression of G proteins and downstream effectors

Methodologically, one approach is to perform parallel experiments with tissue samples containing endogenous receptors and cell lines expressing recombinant receptors, then normalize responses based on receptor density measurements.

What experimental design is optimal for studying the role of pig MTNR1A in reproductive physiology?

For studying pig MTNR1A in reproductive physiology, a comprehensive experimental design should include:

  • Seasonal analysis: Examine MTNR1A expression and function across different seasons

    • Methodology: Collect samples at defined seasonal timepoints with standardized environmental conditions

  • Tissue-specific expression: Focus on hypophysial pars tuberalis and hypothalamic tissues

    • Approach: Use laser capture microdissection for precise tissue isolation

  • Reproductive parameter correlation: Correlate receptor levels with reproductive hormones

    • Techniques: Multiplex hormone assays alongside receptor quantification

  • Functional manipulation: Use RNAi or CRISPR techniques to modify MTNR1A expression

    • Design considerations: Include appropriate controls as demonstrated in studies of other MTNR receptors

Table 2: Experimental Design Elements for Reproductive Studies

Design ElementParameters to MeasureAnalytical Method
Seasonal samplingPhotoperiod, temperature, reproductive statusMultivariate regression
Tissue analysisMTNR1A protein/mRNA levels in target tissuesqPCR, Western blot, IHC
Hormonal profilingLH, FSH, melatonin, progesterone, estradiolELISA, RIA
Genetic manipulationMTNR1A knockdown/overexpression effectsRNA-seq, proteomics

By integrating these approaches, researchers can establish causal relationships between MTNR1A function and reproductive outcomes.

How does recombinant pig MTNR1A compare functionally to human and other mammalian MTNR1A proteins?

Comparative functional analysis of MTNR1A across species provides valuable insights:

  • Binding affinity differences: Compare melatonin binding parameters (Kd, Bmax) across species

    • Methodology: Standardized radioligand binding assays with [125I]-melatonin

  • Signaling pathway conservation: Assess G-protein coupling preferences and downstream effectors

    • Approach: Use identical cellular backgrounds for cross-species comparisons

  • Tissue expression patterns: Compare expression in hypothalamic SCN and hypophysial pars tuberalis

    • Techniques: Cross-species RNA-seq analysis with validated normalization

  • Evolutionary conservation: Analyze functional domains through comparative genomics

    • Tools: Multiple sequence alignment and selection pressure analysis (dN/dS ratios)

Research has shown that MTNR1A belongs to the G-protein coupled receptor 1 family and is expressed in specific brain regions across mammalian species, including the hypothalamic suprachiasmatic nuclei and hypophysial pars tuberalis . These conserved expression patterns suggest functional similarities, though species-specific differences in sensitivity and signaling dynamics may exist.

What are the methodological considerations for adapting experimental protocols from human MTNR1A studies to pig models?

When adapting human MTNR1A experimental protocols to pig models, researchers should consider:

  • Antibody cross-reactivity: Validate antibodies specifically for pig MTNR1A

    • Approach: Use recombinant pig MTNR1A as a positive control for antibody validation

  • Pharmacological differences: Test melatonin analogues and antagonists for species-specific potency

    • Methodology: Establish complete dose-response curves in pig cell systems

  • Assay optimization: Adjust buffer conditions, incubation times, and temperatures

    • Strategy: Systematic optimization through factorial experimental design

  • Physiological parameter translation: Account for species differences in circadian timing and reproductive cycles

    • Approach: Establish pig-specific reference ranges and timing benchmarks

For example, studies on human MTNR1A using synthetic peptide immunogens would need to be adapted with pig-specific peptide sequences for antibody generation, with careful validation to ensure specificity in porcine tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.